Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTGY6QZ0)

DOT Name Colipase (CLPS)
Gene Name CLPS
Related Disease
Non-insulin dependent diabetes ( )
Type-1/2 diabetes ( )
UniProt ID
COL_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF01114 ; PF02740
Sequence
MEKILILLLVALSVAYAAPGPRGIIINLENGELCMNSAQCKSNCCQHSSALGLARCTSMA
SENSECSVKTLYGIYYKCPCERGLTCEGDKTIVGSITNTNFGICHDAGRSKQ
Function
Colipase is a cofactor of pancreatic lipase. It allows the lipase to anchor itself to the lipid-water interface. Without colipase the enzyme is washed off by bile salts, which have an inhibitory effect on the lipase; Enterostatin has a biological activity as a satiety signal.
Tissue Specificity Expressed by the pancreas.
KEGG Pathway
Fat digestion and absorption (hsa04975 )
Reactome Pathway
Retinoid metabolism and transport (R-HSA-975634 )
Digestion of dietary lipid (R-HSA-192456 )

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Non-insulin dependent diabetes DISK1O5Z Limited Genetic Variation [1]
Type-1/2 diabetes DISIUHAP Limited Genetic Variation [2]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Colipase (CLPS). [3]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the methylation of Colipase (CLPS). [4]
------------------------------------------------------------------------------------

References

1 Rapid analysis of colipase gene variants by multicapillary electrophoresis.Electrophoresis. 2015 Jun;36(11-12):1237-43. doi: 10.1002/elps.201400551. Epub 2015 Mar 12.
2 The Arg92Cys colipase polymorphism impairs function and secretion by increasing protein misfolding.J Lipid Res. 2013 Feb;54(2):514-21. doi: 10.1194/jlr.M034066. Epub 2012 Dec 2.
3 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
4 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.