Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTHDMM7O)

• DOT Name: DnaJ homolog subfamily C member 5B (DNAJC5B)
• Synonyms: Cysteine-string protein isoform beta; CSP-beta
• Gene Name: DNAJC5B
• Related Disease: Hepatitis C virus infection
• UniProt ID: DNJ5B_HUMAN
• Pfam ID: PF00226
• Sequence:
  MACNIPNQRQRTLSTTGEALYEILGLHKGASNEEIKKTYRKLALKHHPDKNPDDPAATEK
  FKEINNAHAILTDISKRSIYDKYGSLGLYVAEQFGDENVNTYFMLSSWWAKALFVIVGLL
  TGCYFCCCLCCCCNCCCGHCRPESSVPEEDFYVSPEDLEEQIKSDMEKDVDFPVFLQPTN
  ANEKTQLIKEGSRSYCTDS
• Tissue Specificity: Testis specific.
• KEGG Pathway: Protein processing in endoplasmic reticulum (hsa04141)

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Hepatitis C virus infection	DISQ0M8R	Strong	Biomarker	[1]

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of DnaJ homolog subfamily C member 5B (DNAJC5B).	[2]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of DnaJ homolog subfamily C member 5B (DNAJC5B).	[3]
Rosiglitazone	DMILWZR	Approved	Rosiglitazone increases the expression of DnaJ homolog subfamily C member 5B (DNAJC5B).	[4]
PMID27336223-Compound-5	DM6E50A	Patented	PMID27336223-Compound-5 increases the expression of DnaJ homolog subfamily C member 5B (DNAJC5B).	[4]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of DnaJ homolog subfamily C member 5B (DNAJC5B).	[5]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of DnaJ homolog subfamily C member 5B (DNAJC5B).	[6]

References

• [1] Heat shock proteins HSPB8 and DNAJC5B have HCV antiviral activity.PLoS One. 2017 Nov 28;12(11):e0188467. doi: 10.1371/journal.pone.0188467. eCollection 2017.
• [2] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [3] Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
• [4] PPARgamma controls CD1d expression by turning on retinoic acid synthesis in developing human dendritic cells. J Exp Med. 2006 Oct 2;203(10):2351-62.
• [5] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [6] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.