Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTHQP0L5)

• DOT Name: Fumarylacetoacetate hydrolase domain-containing protein 2A (FAHD2A)
• Synonyms: EC 3.-.-.-
• Gene Name: FAHD2A
• UniProt ID: FAH2A_HUMAN
• EC Number: 3.-.-.-
• Pfam ID: PF01557
• Sequence:
  MLVSGRRRLLTVLLQAQKWPFQPSRDMRLVQFRAPHLVGPHLGLETGNGGGVINLNAFDP
  TLPKTMTQFLEQGEATLSVARRALAAQLPVLPRSEVTFLAPVTRPDKVVCVGMNYVDHCK
  EQNVPVPKEPIIFSKFASSIVGPYDEVVLPPQSQEVDWEVELAVVIGKKGKHIKATDAMA
  HVAGFTVAHDVSARDWQMRRNGKQWLLGKTFDTFCPLGPALVTKDSVADPHNLKICCRVN
  GEVVQSGNTNQMVFKTEDLIAWVSQFVTFYPGDVILTGTPPGVGVFRKPPVFLKKGDEVQ
  CEIEELGVIINKVV
• Function: May have hydrolase activity.

Molecular Interaction Atlas (MIA) of This DOT

11 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Fumarylacetoacetate hydrolase domain-containing protein 2A (FAHD2A).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Fumarylacetoacetate hydrolase domain-containing protein 2A (FAHD2A).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Fumarylacetoacetate hydrolase domain-containing protein 2A (FAHD2A).	[3]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Fumarylacetoacetate hydrolase domain-containing protein 2A (FAHD2A).	[4]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Fumarylacetoacetate hydrolase domain-containing protein 2A (FAHD2A).	[5]
Hydroquinone	DM6AVR4	Approved	Hydroquinone decreases the expression of Fumarylacetoacetate hydrolase domain-containing protein 2A (FAHD2A).	[6]
Cocaine	DMSOX7I	Approved	Cocaine affects the expression of Fumarylacetoacetate hydrolase domain-containing protein 2A (FAHD2A).	[7]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide decreases the expression of Fumarylacetoacetate hydrolase domain-containing protein 2A (FAHD2A).	[9]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Fumarylacetoacetate hydrolase domain-containing protein 2A (FAHD2A).	[10]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Fumarylacetoacetate hydrolase domain-containing protein 2A (FAHD2A).	[11]
QUERCITRIN	DM1DH96	Investigative	QUERCITRIN decreases the expression of Fumarylacetoacetate hydrolase domain-containing protein 2A (FAHD2A).	[12]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Fumarylacetoacetate hydrolase domain-containing protein 2A (FAHD2A).	[8]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [3] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [4] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [5] Endoplasmic reticulum stress contributes to arsenic trioxide-induced intrinsic apoptosis in human umbilical and bone marrow mesenchymal stem cells. Environ Toxicol. 2016 Mar;31(3):314-28.
• [6] Keratinocyte-derived IL-36gama plays a role in hydroquinone-induced chemical leukoderma through inhibition of melanogenesis in human epidermal melanocytes. Arch Toxicol. 2019 Aug;93(8):2307-2320.
• [7] Proteomic analysis of the nucleus accumbens of rats with different vulnerability to cocaine addiction. Neuropharmacology. 2009 Jul;57(1):41-8. doi: 10.1016/j.neuropharm.2009.04.005. Epub 2009 Apr 22.
• [8] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [9] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [10] Isobaric tags for relative and absolute quantitation-based proteomics analysis of the effect of ginger oil on bisphenol A-induced breast cancer cell proliferation. Oncol Lett. 2021 Feb;21(2):101. doi: 10.3892/ol.2020.12362. Epub 2020 Dec 8.
• [11] A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.
• [12] Molecular mechanisms of quercitrin-induced apoptosis in non-small cell lung cancer. Arch Med Res. 2014 Aug;45(6):445-54.