Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTHVPDSD)

• DOT Name: Calmodulin-like protein 6 (CALML6)
• Synonyms: Calglandulin-like protein
• Gene Name: CALML6
• Related Disease:
  Breast cancer
  Advanced cancer
  Brain disease
  Cardiovascular disease
• UniProt ID: CALL6_HUMAN
• Pfam ID: PF13499
• Sequence:
  MGLQQEISLQPWCHHPAESCQTTTDMTERLSAEQIKEYKGVFEMFDEEGNGEVKTGELEW
  LMSLLGINPTKSELASMAKDVDRDNKGFFNCDGFLALMGVYHEKAQNQESELRAAFRVFD
  KEGKGYIDWNTLKYVLMNAGEPLNEVEAEQMMKEADKDGDRTIDYEEFVAMMTGESFKLI
  Q
• Tissue Specificity: Expressed in prostate, thymus, heart, skeleton muscle, bone marrow and ovary.
• KEGG Pathway:
  Ras sig.ling pathway (hsa04014)
  Rap1 sig.ling pathway (hsa04015)
  Calcium sig.ling pathway (hsa04020)
  cGMP-PKG sig.ling pathway (hsa04022)
  cAMP sig.ling pathway (hsa04024)
  Phosphatidylinositol sig.ling system (hsa04070)
  Oocyte meiosis (hsa04114)
  Cellular senescence (hsa04218)
  Adrenergic sig.ling in cardiomyocytes (hsa04261)
  Vascular smooth muscle contraction (hsa04270)
  Apelin sig.ling pathway (hsa04371)
  C-type lectin receptor sig.ling pathway (hsa04625)
  Circadian entrainment (hsa04713)
  Long-term potentiation (hsa04720)
  Neurotrophin sig.ling pathway (hsa04722)
  Dopaminergic sy.pse (hsa04728)
  Olfactory transduction (hsa04740)
  Phototransduction (hsa04744)
  Inflammatory mediator regulation of TRP channels (hsa04750)
  Insulin sig.ling pathway (hsa04910)
  GnRH sig.ling pathway (hsa04912)
  Estrogen sig.ling pathway (hsa04915)
  Melanogenesis (hsa04916)
  Oxytocin sig.ling pathway (hsa04921)
  Glucagon sig.ling pathway (hsa04922)
  Renin secretion (hsa04924)
  Aldosterone synthesis and secretion (hsa04925)
  Salivary secretion (hsa04970)
  Gastric acid secretion (hsa04971)
  Alzheimer disease (hsa05010)
  Parkinson disease (hsa05012)
  Pathways of neurodegeneration - multiple diseases (hsa05022)
  Amphetamine addiction (hsa05031)
  Alcoholism (hsa05034)
  Pertussis (hsa05133)
  Tuberculosis (hsa05152)
  Human cytomegalovirus infection (hsa05163)
  Kaposi sarcoma-associated herpesvirus infection (hsa05167)
  Human immunodeficiency virus 1 infection (hsa05170)
  Pathways in cancer (hsa05200)
  Glioma (hsa05214)
  Lipid and atherosclerosis (hsa05417)
  Fluid shear stress and atherosclerosis (hsa05418)

Molecular Interaction Atlas (MIA) of This DOT

4 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Breast cancer	DIS7DPX1	Strong	Biomarker	[1]
Advanced cancer	DISAT1Z9	moderate	Genetic Variation	[2]
Brain disease	DIS6ZC3X	moderate	Genetic Variation	[2]
Cardiovascular disease	DIS2IQDX	moderate	Genetic Variation	[2]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Calmodulin-like protein 6 (CALML6).	[3]

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Calmodulin-like protein 6 (CALML6).	[4]

References

• [1] EF Hand Protein IBA2 Promotes Cell Proliferation in Breast Cancers via Transcriptional Control of Cyclin D1.Cancer Res. 2016 Aug 1;76(15):4535-45. doi: 10.1158/0008-5472.CAN-15-2927. Epub 2016 Jun 4.
• [2] S100 proteins: Diagnostic and prognostic biomarkers in laboratory medicine.Biochim Biophys Acta Mol Cell Res. 2019 Jul;1866(7):1197-1206. doi: 10.1016/j.bbamcr.2018.10.015. Epub 2018 Oct 28.
• [3] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [4] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.