Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTI2IF40)

• DOT Name: Small integral membrane protein 29 (SMIM29)
• Synonyms: Protein LBH
• Gene Name: SMIM29
• UniProt ID: SIM29_HUMAN
• Sequence:
  MSNTTVPNAPQANSDSMVGYVLGPFFLITLVGVVVAVVMYVQKKKRVDRLRHHLLPMYSY
  DPAEELHEAEQELLSDMGDPKVVHGWQSGYQHKRMPLLDVKT
• Tissue Specificity: Expressed in spleen, thymus, prostate, testis, uterus, small intestine, colon and peripheral blood leukocytes.

Molecular Interaction Atlas (MIA) of This DOT

13 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Small integral membrane protein 29 (SMIM29).	[1]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Small integral membrane protein 29 (SMIM29).	[2]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Small integral membrane protein 29 (SMIM29).	[3]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Small integral membrane protein 29 (SMIM29).	[4]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Small integral membrane protein 29 (SMIM29).	[5]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Small integral membrane protein 29 (SMIM29).	[6]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Small integral membrane protein 29 (SMIM29).	[7]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Small integral membrane protein 29 (SMIM29).	[7]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Small integral membrane protein 29 (SMIM29).	[8]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Small integral membrane protein 29 (SMIM29).	[9]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Small integral membrane protein 29 (SMIM29).	[10]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Small integral membrane protein 29 (SMIM29).	[11]
PP-242	DM2348V	Investigative	PP-242 increases the expression of Small integral membrane protein 29 (SMIM29).	[12]

References

• [1] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [2] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [3] Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
• [4] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [5] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [6] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [7] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [8] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [9] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [10] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [11] Bisphenol A and bisphenol S induce distinct transcriptional profiles in differentiating human primary preadipocytes. PLoS One. 2016 Sep 29;11(9):e0163318.
• [12] Marine biogenics in sea spray aerosols interact with the mTOR signaling pathway. Sci Rep. 2019 Jan 24;9(1):675.