Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTI4ZFP8)

DOT Name Zinc finger protein neuro-d4 (DPF1)
Synonyms BRG1-associated factor 45B; BAF45B; D4, zinc and double PHD fingers family 1
Gene Name DPF1
Related Disease
Adult glioblastoma ( )
Glioblastoma multiforme ( )
UniProt ID
DPF1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF14051 ; PF00628
Sequence
MATVIPGPLSLGEDFYREAIEHCRSYNARLCAERSLRLPFLDSQTGVAQNNCYIWMEKTH
RGPGLAPGQIYTYPARCWRKKRRLNILEDPRLRPCEYKIDCEAPLKKEGGLPEGPVLEAL
LCAETGEKKIELKEEETIMDCQKQQLLEFPHDLEVEDLEDDIPRRKNRAKGKAYGIGGLR
KRQDTASLEDRDKPYVCDICGKRYKNRPGLSYHYTHTHLAEEEGEENAERHALPFHRKNN
HKQFYKELAWVPEAQRKHTAKKAPDGTVIPNGYCDFCLGGSKKTGCPEDLISCADCGRSG
HPSCLQFTVNMTAAVRTYRWQCIECKSCSLCGTSENDDQLLFCDDCDRGYHMYCLSPPMA
EPPEGSWSCHLCLRHLKEKASAYITLT
Function
May have an important role in developing neurons by participating in regulation of cell survival, possibly as a neurospecific transcription factor. Belongs to the neuron-specific chromatin remodeling complex (nBAF complex). During neural development a switch from a stem/progenitor to a postmitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural stem/progenitor cells to postmitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF). The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural stem cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth.
KEGG Pathway
ATP-dependent chromatin remodeling (hsa03082 )
Thermogenesis (hsa04714 )
Hepatocellular carcinoma (hsa05225 )

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Adult glioblastoma DISVP4LU Strong Biomarker [1]
Glioblastoma multiforme DISK8246 Strong Biomarker [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
3 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Zinc finger protein neuro-d4 (DPF1). [2]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Zinc finger protein neuro-d4 (DPF1). [6]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the methylation of Zinc finger protein neuro-d4 (DPF1). [9]
------------------------------------------------------------------------------------
7 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Temozolomide DMKECZD Approved Temozolomide decreases the expression of Zinc finger protein neuro-d4 (DPF1). [3]
Calcitriol DM8ZVJ7 Approved Calcitriol decreases the expression of Zinc finger protein neuro-d4 (DPF1). [4]
Testosterone DM7HUNW Approved Testosterone decreases the expression of Zinc finger protein neuro-d4 (DPF1). [4]
Urethane DM7NSI0 Phase 4 Urethane increases the expression of Zinc finger protein neuro-d4 (DPF1). [5]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 decreases the expression of Zinc finger protein neuro-d4 (DPF1). [7]
THAPSIGARGIN DMDMQIE Preclinical THAPSIGARGIN decreases the expression of Zinc finger protein neuro-d4 (DPF1). [8]
Trichostatin A DM9C8NX Investigative Trichostatin A affects the expression of Zinc finger protein neuro-d4 (DPF1). [10]
------------------------------------------------------------------------------------
⏷ Show the Full List of 7 Drug(s)

References

1 The role of the SWI/SNF chromatin remodeling complex in maintaining the stemness of glioma initiating cells.Sci Rep. 2017 Apr 18;7(1):889. doi: 10.1038/s41598-017-00982-3.
2 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
3 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
4 Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
5 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
6 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
7 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
8 Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
9 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
10 A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.