Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTISKGMK)

DOT Name Katanin p60 ATPase-containing subunit A1 (KATNA1)
Synonyms Katanin p60 subunit A1; EC 5.6.1.1; p60 katanin
Gene Name KATNA1
Related Disease
Epithelial ovarian cancer ( )
Lung carcinoma ( )
Ovarian cancer ( )
Ovarian neoplasm ( )
UniProt ID
KTNA1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
5ZQL; 5ZQM
EC Number
5.6.1.1
Pfam ID
PF00004 ; PF17862 ; PF21126 ; PF09336
Sequence
MSLLMISENVKLAREYALLGNYDSAMVYYQGVLDQMNKYLYSVKDTYLQQKWQQVWQEIN
VEAKHVKDIMKTLESFKLDSTPLKAAQHDLPASEGEVWSMPVPVERRPSPGPRKRQSSQY
SDPKSHGNRPSTTVRVHRSSAQNVHNDRGKAVRCREKKEQNKGREEKNKSPAAVTEPETN
KFDSTGYDKDLVEALERDIISQNPNVRWDDIADLVEAKKLLKEAVVLPMWMPEFFKGIRR
PWKGVLMVGPPGTGKTLLAKAVATECKTTFFNVSSSTLTSKYRGESEKLVRLLFEMARFY
SPATIFIDEIDSICSRRGTSEEHEASRRVKAELLVQMDGVGGTSENDDPSKMVMVLAATN
FPWDIDEALRRRLEKRIYIPLPSAKGREELLRISLRELELADDVDLASIAENMEGYSGAD
ITNVCRDASLMAMRRRIEGLTPEEIRNLSKEEMHMPTTMEDFEMALKKVSKSVSAADIER
YEKWIFEFGSC
Function
Catalytic subunit of a complex which severs microtubules in an ATP-dependent manner. Microtubule severing may promote rapid reorganization of cellular microtubule arrays and the release of microtubules from the centrosome following nucleation. Microtubule release from the mitotic spindle poles may allow depolymerization of the microtubule end proximal to the spindle pole, leading to poleward microtubule flux and poleward motion of chromosome. Microtubule release within the cell body of neurons may be required for their transport into neuronal processes by microtubule-dependent motor proteins. This transport is required for axonal growth.

Molecular Interaction Atlas (MIA) of This DOT

4 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Epithelial ovarian cancer DIS56MH2 Strong Biomarker [1]
Lung carcinoma DISTR26C Strong Genetic Variation [2]
Ovarian cancer DISZJHAP Strong Biomarker [1]
Ovarian neoplasm DISEAFTY Strong Biomarker [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
6 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Katanin p60 ATPase-containing subunit A1 (KATNA1). [3]
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of Katanin p60 ATPase-containing subunit A1 (KATNA1). [4]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Katanin p60 ATPase-containing subunit A1 (KATNA1). [5]
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of Katanin p60 ATPase-containing subunit A1 (KATNA1). [6]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of Katanin p60 ATPase-containing subunit A1 (KATNA1). [7]
Urethane DM7NSI0 Phase 4 Urethane increases the expression of Katanin p60 ATPase-containing subunit A1 (KATNA1). [8]
------------------------------------------------------------------------------------
⏷ Show the Full List of 6 Drug(s)
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 decreases the phosphorylation of Katanin p60 ATPase-containing subunit A1 (KATNA1). [9]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the methylation of Katanin p60 ATPase-containing subunit A1 (KATNA1). [10]
------------------------------------------------------------------------------------

References

1 Clinical relevance of cytoskeleton associated proteins for ovarian cancer.J Cancer Res Clin Oncol. 2018 Nov;144(11):2195-2205. doi: 10.1007/s00432-018-2710-9. Epub 2018 Aug 9.
2 Genome-wide association study confirms lung cancer susceptibility loci on chromosomes 5p15 and 15q25 in an African-American population.Lung Cancer. 2016 Aug;98:33-42. doi: 10.1016/j.lungcan.2016.05.008. Epub 2016 May 13.
3 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
4 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
5 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
6 Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
7 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
8 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
9 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
10 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.