Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTISM8ZT)

• DOT Name: Small integral membrane protein 10 (SMIM10)
• Gene Name: SMIM10
• Related Disease: Melanoma
• UniProt ID: SIM10_HUMAN
• Pfam ID: PF15118
• Sequence:
  MEALGSGHYVGGSIRSMAAAALSGLAVRLSRPQGTRGSYGAFCKTLTRTLLTFFDLAWRL
  RKNFFYFYILASVILNVHLQVYI

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Melanoma	DIS1RRCY	Strong	Biomarker	[1]

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Small integral membrane protein 10 (SMIM10).	[2]
Diethylstilbestrol	DMN3UXQ	Approved	Diethylstilbestrol decreases the expression of Small integral membrane protein 10 (SMIM10).	[3]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Small integral membrane protein 10 (SMIM10).	[5]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Small integral membrane protein 10 (SMIM10).	[4]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Small integral membrane protein 10 (SMIM10).	[6]

References

• [1] Development of a yeast-based system to identify new hBRAFV600E functional interactors.Oncogene. 2019 Feb;38(8):1355-1366. doi: 10.1038/s41388-018-0496-5. Epub 2018 Sep 20.
• [2] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [3] Identification of biomarkers and outcomes of endocrine disruption in human ovarian cortex using In Vitro Models. Toxicology. 2023 Feb;485:153425. doi: 10.1016/j.tox.2023.153425. Epub 2023 Jan 5.
• [4] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [5] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [6] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.