Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTJ5X4CR)

• DOT Name: Claudin domain-containing protein 2 (CLDND2)
• Gene Name: CLDND2
• UniProt ID: CLDN2_HUMAN
• Pfam ID: PF00822
• Sequence:
  MGVKRSLQSGGILLSLVANVLMVLSTATNYWTRQQEGHSGLWQECNHGICSSIPCQTTLA
  VTVACMVLAVGVGVVGMVMGLRIRCDEGESLRGQTTSAFLFLGGLLLLTALIGYTVKNAW
  KNNVFFSWSYFSGWLALPFSILAGFCFLLADMIMQSTDAISGFPVCL

Molecular Interaction Atlas (MIA) of This DOT

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Claudin domain-containing protein 2 (CLDND2).	[1]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Claudin domain-containing protein 2 (CLDND2).	[4]

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Claudin domain-containing protein 2 (CLDND2).	[2]
Testosterone	DM7HUNW	Approved	Testosterone increases the expression of Claudin domain-containing protein 2 (CLDND2).	[3]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of Claudin domain-containing protein 2 (CLDND2).	[5]
KOJIC ACID	DMP84CS	Investigative	KOJIC ACID decreases the expression of Claudin domain-containing protein 2 (CLDND2).	[6]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [3] The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
• [4] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [5] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [6] Toxicogenomics of kojic acid on gene expression profiling of a375 human malignant melanoma cells. Biol Pharm Bull. 2006 Apr;29(4):655-69.