Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTJ8MXU4)

• DOT Name: Cysteine-rich tail protein 1 (CYSRT1)
• Gene Name: CYSRT1
• UniProt ID: CRTP1_HUMAN
• Pfam ID: PF10631
• Sequence:
  MDPQEMVVKNPYAHISIPRAHLRPDLGQQLEVASTCSSSSEMQPLPVGPCAPEPTHLLQP
  TEVPGPKGAKGNQGAAPIQNQQAWQQPGNPYSSSQRQAGLTYAGPPPAGRGDDIAHHCCC
  CPCCHCCHCPPFCRCHSCCCCVIS
• Function: Component of the stratum corneum that may contribute to epidermal antimicrobial host defenses.
• Tissue Specificity: Expressed in the stratum granulosum, in skin and oral epithelia (at protein level).

Molecular Interaction Atlas (MIA) of This DOT

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Cysteine-rich tail protein 1 (CYSRT1).	[1]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Cysteine-rich tail protein 1 (CYSRT1).	[8]

10 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Cysteine-rich tail protein 1 (CYSRT1).	[2]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Cysteine-rich tail protein 1 (CYSRT1).	[3]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Cysteine-rich tail protein 1 (CYSRT1).	[4]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Cysteine-rich tail protein 1 (CYSRT1).	[5]
Hydroquinone	DM6AVR4	Approved	Hydroquinone increases the expression of Cysteine-rich tail protein 1 (CYSRT1).	[6]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Cysteine-rich tail protein 1 (CYSRT1).	[7]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Cysteine-rich tail protein 1 (CYSRT1).	[9]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Cysteine-rich tail protein 1 (CYSRT1).	[3]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Cysteine-rich tail protein 1 (CYSRT1).	[10]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Cysteine-rich tail protein 1 (CYSRT1).	[11]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [3] Comparative Analysis of Transcriptomic Changes including mRNA and microRNA Expression Induced by the Xenoestrogens Zearalenone and Bisphenol A in Human Ovarian Cells. Toxins (Basel). 2023 Feb 9;15(2):140. doi: 10.3390/toxins15020140.
• [4] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [5] Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
• [6] Keratinocyte-derived IL-36gama plays a role in hydroquinone-induced chemical leukoderma through inhibition of melanogenesis in human epidermal melanocytes. Arch Toxicol. 2019 Aug;93(8):2307-2320.
• [7] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [8] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [9] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [10] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [11] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.