Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTJE0DU1)

• DOT Name: Cilia- and flagella-associated protein 95 (CFAP95)
• Gene Name: CFAP95
• UniProt ID: CFA95_HUMAN
• PDB ID: 7UNG; 8J07
• Pfam ID: PF15139
• Sequence:
  MDSLDRSCQDWCDRKQHWLEIGPPDLVERKGSLTLRSHHKKYSKPVLVYSWHRDREAFPK
  GYDIEGPEKVKKLCNSTYRRLGTDESPIWTSETHEKLSQMCLNTEWVEMKSKALLNEETV
  SSGIIERVTGLPATGFGAVFPRHPPDWSKMCALTTYSEDYVPPYDYQPHAYPCQDDYSIV
  HRKCRSQFTDLNGSKRFGINTWHDESGIYANSDVKQKLYPLTSGPIVPI
• Function: Microtubule inner protein (MIP) part of the dynein-decorated doublet microtubules (DMTs) in cilia axoneme, which is required for motile cilia beating.
• Tissue Specificity: Expressed in undifferentiated embryonic stem cells. Expressed in airway epithelial cells .

Molecular Interaction Atlas (MIA) of This DOT

6 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Cilia- and flagella-associated protein 95 (CFAP95).	[1]
Cisplatin	DMRHGI9	Approved	Cisplatin affects the expression of Cilia- and flagella-associated protein 95 (CFAP95).	[2]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Cilia- and flagella-associated protein 95 (CFAP95).	[3]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Cilia- and flagella-associated protein 95 (CFAP95).	[2]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Cilia- and flagella-associated protein 95 (CFAP95).	[4]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Cilia- and flagella-associated protein 95 (CFAP95).	[6]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Cilia- and flagella-associated protein 95 (CFAP95).	[5]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [3] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [4] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [5] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [6] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.