| DOT Name |
T-cell surface glycoprotein CD3 gamma chain (CD3G)
|
| Synonyms |
T-cell receptor T3 gamma chain; CD antigen CD3g |
| Gene Name |
CD3G
|
| Related Disease |
- Combined immunodeficiency due to CD3gamma deficiency ( )
|
| UniProt ID |
|
| 3D Structure |
|
| PDB ID |
1SY6 ; 6JXR ; 7FJD ; 7FJE ; 7FJF ; 7PHR ; 7Q5U ; 8ES7 ; 8ES8 ; 8ES9 |
| Pfam ID |
|
| Sequence |
MEQGKGLAVLILAIILLQGTLAQSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGK
MIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELNAATISGFLF
AEIVSIFVLAVGVYFIAGQDGVRQSRASDKQTLLPNDQLYQPLKDREDDQYSHLQGNQLR
RN
|
| Function |
Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these motifs become phosphorylated by Src family protein tyrosine kinases LCK and FYN, resulting in the activation of downstream signaling pathways. In addition to this role of signal transduction in T-cell activation, CD3G plays an essential role in the dynamic regulation of TCR expression at the cell surface. Indeed, constitutive TCR cycling is dependent on the di-leucine-based (diL) receptor-sorting motif present in CD3G.
|
| KEGG Pathway |
- Hematopoietic cell lineage (hsa04640 )
- Th1 and Th2 cell differentiation (hsa04658 )
- Th17 cell differentiation (hsa04659 )
- T cell receptor sig.ling pathway (hsa04660 )
- Chagas disease (hsa05142 )
- Measles (hsa05162 )
- Human T-cell leukemia virus 1 infection (hsa05166 )
- Epstein-Barr virus infection (hsa05169 )
- Human immunodeficiency virus 1 infection (hsa05170 )
- PD-L1 expression and PD-1 checkpoint pathway in cancer (hsa05235 )
|
| Reactome Pathway |
- Downstream TCR signaling (R-HSA-202424 )
- Phosphorylation of CD3 and TCR zeta chains (R-HSA-202427 )
- Translocation of ZAP-70 to Immunological synapse (R-HSA-202430 )
- Generation of second messenger molecules (R-HSA-202433 )
- FCGR activation (R-HSA-2029481 )
- Regulation of actin dynamics for phagocytic cup formation (R-HSA-2029482 )
- Role of phospholipids in phagocytosis (R-HSA-2029485 )
- PD-1 signaling (R-HSA-389948 )
- Cargo recognition for clathrin-mediated endocytosis (R-HSA-8856825 )
- Clathrin-mediated endocytosis (R-HSA-8856828 )
- FCGR3A-mediated IL10 synthesis (R-HSA-9664323 )
- FCGR3A-mediated phagocytosis (R-HSA-9664422 )
- Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell (R-HSA-198933 )
|
|
|
|
|
|
|
