Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTKE53HT)

DOT Name Tetratricopeptide repeat protein 38 (TTC38)
Synonyms TPR repeat protein 38
Gene Name TTC38
Related Disease
Rheumatoid arthritis ( )
UniProt ID
TTC38_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MAAASPLRDCQAWKDARLPLSTTSNEACKLFDATLTQYVKWTNDKSLGGIEGCLSKLKAA
DPTFVMGHAMATGLVLIGTGSSVKLDKELDLAVKTMVEISRTQPLTRREQLHVSAVETFA
NGNFPKACELWEQILQDHPTDMLALKFSHDAYFYLGYQEQMRDSVARIYPFWTPDIPLSS
YVKGIYSFGLMETNFYDQAEKLAKEALSINPTDAWSVHTVAHIHEMKAEIKDGLEFMQHS
ETFWKDSDMLACHNYWHWALYLIEKGEYEAALTIYDTHILPSLQANDAMLDVVDSCSMLY
RLQMEGVSVGQRWQDVLPVARKHSRDHILLFNDAHFLMASLGAHDPQTTQELLTTLRDAS
ESPGENCQHLLARDVGLPLCQALVEAEDGNPDRVLELLLPIRYRIVQLGGSNAQRDVFNQ
LLIHAALNCTSSVHKNVARSLLMERDALKPNSPLTERLIRKAATVHLMQ

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Rheumatoid arthritis DISTSB4J Definitive Biomarker [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
10 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Tetratricopeptide repeat protein 38 (TTC38). [2]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Tetratricopeptide repeat protein 38 (TTC38). [3]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Tetratricopeptide repeat protein 38 (TTC38). [4]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Tetratricopeptide repeat protein 38 (TTC38). [5]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Tetratricopeptide repeat protein 38 (TTC38). [6]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Tetratricopeptide repeat protein 38 (TTC38). [7]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide increases the expression of Tetratricopeptide repeat protein 38 (TTC38). [8]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Tetratricopeptide repeat protein 38 (TTC38). [9]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Tetratricopeptide repeat protein 38 (TTC38). [10]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 decreases the expression of Tetratricopeptide repeat protein 38 (TTC38). [12]
------------------------------------------------------------------------------------
⏷ Show the Full List of 10 Drug(s)
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
TAK-243 DM4GKV2 Phase 1 TAK-243 increases the sumoylation of Tetratricopeptide repeat protein 38 (TTC38). [11]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the methylation of Tetratricopeptide repeat protein 38 (TTC38). [13]
------------------------------------------------------------------------------------

References

1 New genes associated with rheumatoid arthritis identified by gene expression profiling.Int J Immunogenet. 2017 Jun;44(3):107-113. doi: 10.1111/iji.12313. Epub 2017 Apr 2.
2 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
3 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
4 Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
5 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
6 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
7 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
8 Arsenic suppresses gene expression in promyelocytic leukemia cells partly through Sp1 oxidation. Blood. 2005 Jul 1;106(1):304-10.
9 Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
10 Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
11 Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
12 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
13 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.