Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTKJ49P2)

• DOT Name: Vesicle transport protein SFT2A (SFT2D1)
• Synonyms: SFT2 domain-containing protein 1; pRGR1
• Gene Name: SFT2D1
• UniProt ID: SFT2A_HUMAN
• Pfam ID: PF04178
• Sequence:
  MEKLRRVLSGQDDEEQGLTAQVLDASSLSFNTRLKWFAICFVCGVFFSILGTGLLWLPGG
  IKLFAVFYTLGNLAALASTCFLMGPVKQLKKMFEATRLLATIVMLLCFIFTLCAALWWHK
  KGLAVLFCILQFLSMTWYSLSYIPYARDAVIKCCSSLLS
• Function: May be involved in fusion of retrograde transport vesicles derived from an endocytic compartment with the Golgi complex.

Molecular Interaction Atlas (MIA) of This DOT

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Vesicle transport protein SFT2A (SFT2D1).	[1]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Vesicle transport protein SFT2A (SFT2D1).	[2]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Vesicle transport protein SFT2A (SFT2D1).	[3]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Vesicle transport protein SFT2A (SFT2D1).	[4]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Vesicle transport protein SFT2A (SFT2D1).	[5]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Vesicle transport protein SFT2A (SFT2D1).	[6]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Vesicle transport protein SFT2A (SFT2D1).	[7]
chloropicrin	DMSGBQA	Investigative	chloropicrin increases the expression of Vesicle transport protein SFT2A (SFT2D1).	[8]

References

• [1] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [2] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [3] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [4] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [5] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [6] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [7] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [8] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.