Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTL3E0G7)

DOT Name	Melanoma-associated antigen E2 (MAGEE2)
Synonyms	Hepatocellular carcinoma-associated protein 3; MAGE-E2 antigen
Gene Name	MAGEE2
Related Disease	Advanced cancer ( ) Arteriosclerosis ( ) Atherosclerosis ( ) Breast cancer ( ) Breast carcinoma ( ) Obesity ( ) Obsolete male infertility with azoospermia or oligozoospermia due to single gene mutation ( )
UniProt ID	MAGE2_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF01454
Sequence	MSLVSQNARHCSAEITADYGDGRGEIQATNASGSPTSMLVVDAPQCPQAPINSQCVNTSQ AVQDPNDLEVLIDEQSRRLGALRVHDPLEDRSIALVNFMRMKSQTEGSIQQSEMLEFLRE YSDQFPEILRRASAHLDQVFGLNLRVIDPQADTYNLVSKRGFQITDRIAESLDMPKASLL ALVLGHILLNGNRAREASIWDLLLKVDMWDKPQRINNLFGNTRNLLTTDFVCMRFLEYWP VYGTNPLEFEFLWGSRAHREITKMEALKFVSDAHDEEPWSWPEEYNKALEGDKTKERSLT AGLEFWSEDTMNDKANDLVQLAISVTEEMLPIHQDELLAHTGKEFEDVFPNILNRATLIL DMFYGLSLIEVDTSEHIYLLVQQPESEEEQVMLESLGRPTQEYVMPILGLIFLMGNRVKE ANVWNLLRRFSVDVGRKHSITRKLMRQRYLECRPLSYSNPVEYELLWGPRAHHETIKMKV LEYMARLYRKRPQNWPEQYREAVEDEEARAKSEATIMFFLDPT

Molecular Interaction Atlas (MIA) of This DOT

7 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Advanced cancer	DISAT1Z9	Strong	Biomarker	[1]
Arteriosclerosis	DISK5QGC	Strong	Biomarker	[2]
Atherosclerosis	DISMN9J3	Strong	Biomarker	[2]
Breast cancer	DIS7DPX1	Strong	Biomarker	[1]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[1]
Obesity	DIS47Y1K	Strong	Biomarker	[2]
Obsolete male infertility with azoospermia or oligozoospermia due to single gene mutation	DIS56JR8	Moderate	X-linked	[3]
------------------------------------------------------------------------------------


⏷ Show the Full List of 7 Disease(s)

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Melanoma-associated antigen E2 (MAGEE2).	[4]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Melanoma-associated antigen E2 (MAGEE2).	[6]
------------------------------------------------------------------------------------

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Melanoma-associated antigen E2 (MAGEE2).	[5]
------------------------------------------------------------------------------------

References

1	Hydroxycarboxylic acid receptors are essential for breast cancer cells to control their lipid/fatty acid metabolism.Oncotarget. 2015 Aug 14;6(23):19706-20. doi: 10.18632/oncotarget.3565.
2	Hydroxycarboxylic Acid Receptor Ligands Modulate Proinflammatory Cytokine Expression in Human Macrophages and Adipocytes without Affecting Adipose Differentiation.Biol Pharm Bull. 2018;41(10):1574-1580. doi: 10.1248/bpb.b18-00301.
3	A genomics approach to male infertility. Genet Med. 2020 Dec;22(12):1967-1975. doi: 10.1038/s41436-020-0916-0. Epub 2020 Jul 28.
4	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
5	Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
6	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.