Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTL6I6AI)

• DOT Name: Protein FAM216A (FAM216A)
• Gene Name: FAM216A
• UniProt ID: F216A_HUMAN
• Pfam ID: PF15107
• Sequence:
  MLGQLLPHTARGLGAAEMPGQGPGSDWTERSSSAEPPAVAGTEGGGGGSAGYSCYQNSKG
  SDRIKDGYKVNSHIAKLQELWKTPQNQTIHLSKSMMEASFFKHPDLTTGQKRYLCSIAKI
  YNANYLKMLMKRQYMHVLQHSSQKPGVLTHHRSRLSSRYSQKQHYPCTTWRHQLEREDSG
  SSDIAAASAPEMLIQHSLWRPVRNKEGIKTGYASKTRCKSLKIFRRPRKLFMQTVSSDDS
  ESHMSEEKKEEDLLNNFMQSMSIEEQGEHLMLT

Molecular Interaction Atlas (MIA) of This DOT

15 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Protein FAM216A (FAM216A).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Protein FAM216A (FAM216A).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Protein FAM216A (FAM216A).	[3]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Protein FAM216A (FAM216A).	[4]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Protein FAM216A (FAM216A).	[5]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Protein FAM216A (FAM216A).	[6]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Protein FAM216A (FAM216A).	[7]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Protein FAM216A (FAM216A).	[7]
Dexamethasone	DMMWZET	Approved	Dexamethasone decreases the expression of Protein FAM216A (FAM216A).	[8]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Protein FAM216A (FAM216A).	[9]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Protein FAM216A (FAM216A).	[10]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Protein FAM216A (FAM216A).	[11]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Protein FAM216A (FAM216A).	[13]
Coumestrol	DM40TBU	Investigative	Coumestrol increases the expression of Protein FAM216A (FAM216A).	[14]
QUERCITRIN	DM1DH96	Investigative	QUERCITRIN decreases the expression of Protein FAM216A (FAM216A).	[15]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
TAK-243	DM4GKV2	Phase 1	TAK-243 increases the sumoylation of Protein FAM216A (FAM216A).	[12]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [3] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [4] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [5] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [6] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [7] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [8] Gene expression profile of human lymphoid CEM cells sensitive and resistant to glucocorticoid-evoked apoptosis. Genomics. 2003 Jun;81(6):543-55.
• [9] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [10] Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
• [11] BET bromodomain inhibition of MYC-amplified medulloblastoma. Clin Cancer Res. 2014 Feb 15;20(4):912-25.
• [12] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [13] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [14] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [15] Molecular mechanisms of quercitrin-induced apoptosis in non-small cell lung cancer. Arch Med Res. 2014 Aug;45(6):445-54.