Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTLNQ7ZW)

• DOT Name: Centrosomal protein 20 (CEP20)
• Synonyms: FGFR1OP N-terminal-like protein; FOP-related protein of 20 kDa; LisH domain-containing protein FOPNL
• Gene Name: CEP20
• UniProt ID: CEP20_HUMAN
• Pfam ID: PF09398
• Sequence:
  MATVAELKAVLKDTLEKKGVLGHLKARIRAEVFNALDDDREPRPSLSHENLLINELIREY
  LEFNKYKYTASVLIAESGQPVVPLDRQFLIHELNAFEESKDNTIPLLYGILAHFLRGTKD
  GIQNAFLKGPSLQPSDPSLGRQPSRRKPMDDHLRKEEQKSTNIEDLHVSQAVNR
• Function: Involved in the biogenesis of cilia. Required for the recruitment of PLK1 to centrosomes and S phase progression.
• Tissue Specificity: Widely expressed. Detected in brain, heart, kidney, liver, lung, skeletal muscle, placenta and intestine.

Molecular Interaction Atlas (MIA) of This DOT

6 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Centrosomal protein 20 (CEP20).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Centrosomal protein 20 (CEP20).	[2]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Centrosomal protein 20 (CEP20).	[3]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of Centrosomal protein 20 (CEP20).	[4]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Centrosomal protein 20 (CEP20).	[6]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane increases the expression of Centrosomal protein 20 (CEP20).	[7]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Centrosomal protein 20 (CEP20).	[5]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [3] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [4] The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
• [5] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [6] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [7] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.