Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTLUZISP)

• DOT Name: Magnesium-dependent phosphatase 1 (MDP1)
• Synonyms: MDP-1; EC 3.1.3.-; EC 3.1.3.48
• Gene Name: MDP1
• Related Disease:
  Latent tuberculosis infection
  MYH7-related skeletal myopathy
  Neoplasm
  Tuberculosis
  Gastric cancer
  Stomach cancer
• UniProt ID: MGDP1_HUMAN
• PDB ID: 2WM8
• EC Number: 3.1.3.-; 3.1.3.48
• Pfam ID: PF12689
• Sequence:
  MARLPKLAVFDLDYTLWPFWVDTHVDPPFHKSSDGTVRDRRGQDVRLYPEVPEVLKRLQS
  LGVPGAAASRTSEIEGANQLLELFDLFRYFVHREIYPGSKITHFERLQQKTGIPFSQMIF
  FDDERRNIVDVSKLGVTCIHIQNGMNLQTLSQGLETFAKAQTGPLRSSLEESPFEA
• Function: Magnesium-dependent phosphatase which may act as a tyrosine phosphatase.

Molecular Interaction Atlas (MIA) of This DOT

6 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Latent tuberculosis infection	DIS6R1EH	Strong	Biomarker	[1]
MYH7-related skeletal myopathy	DIS5EQO5	Strong	Biomarker	[2]
Neoplasm	DISZKGEW	Strong	Altered Expression	[3]
Tuberculosis	DIS2YIMD	Strong	Altered Expression	[1]
Gastric cancer	DISXGOUK	Limited	Altered Expression	[4]
Stomach cancer	DISKIJSX	Limited	Altered Expression	[4]

5 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Magnesium-dependent phosphatase 1 (MDP1).	[5]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Magnesium-dependent phosphatase 1 (MDP1).	[6]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Magnesium-dependent phosphatase 1 (MDP1).	[7]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Magnesium-dependent phosphatase 1 (MDP1).	[8]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Magnesium-dependent phosphatase 1 (MDP1).	[9]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Magnesium-dependent phosphatase 1 (MDP1).	[10]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Magnesium-dependent phosphatase 1 (MDP1).	[11]

References

• [1] Serum antibody profiles in individuals with latent Mycobacterium tuberculosis infection.Microbiol Immunol. 2019 Mar;63(3-4):130-138. doi: 10.1111/1348-0421.12674. Epub 2019 Apr 9.
• [2] Inheritance and genetic mapping of the Campus syndrome (CPS): a high-frequency tremor disease in pigs.J Hered. 1999 Jul-Aug;90(4):472-6. doi: 10.1093/jhered/90.4.472.
• [3] Expression and prognostic roles of magnesium-dependent phosphatase-1 in gastric cancer.Eur Rev Med Pharmacol Sci. 2017 Jun;21(11):2617-2625.
• [4] Magnesium-dependent Phosphatase (MDP) 1 is a Potential Suppressor of Gastric Cancer.Curr Cancer Drug Targets. 2019;19(10):817-827. doi: 10.2174/1568009619666190620112546.
• [5] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [6] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [7] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [8] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [9] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [10] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [11] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.