Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTMECF5R)

• DOT Name: Carcinoembryonic antigen-related cell adhesion molecule 19 (CEACAM19)
• Synonyms: Carcinoembryonic antigen-like 1
• Gene Name: CEACAM19
• Related Disease:
  Alzheimer disease
  Breast cancer
  Breast carcinoma
  Penile cancer
  Gastric cancer
  Stomach cancer
• UniProt ID: CEA19_HUMAN
• Pfam ID: PF07686
• Sequence:
  MEIPMGTQGCFSKSLLLSASILVLWMLQGSQAALYIQKIPEQPQKNQDLLLSVQGVPDTF
  QDFNWYLGEETYGGTRLFTYIPGIQRPQRDGSAMGQRDIVGFPNGSMLLRRAQPTDSGTY
  QVAITINSEWTMKAKTEVQVAEKNKELPSTHLPTNAGILAATIIGSLAAGALLISCIAYL
  LVTRNWRGQSHRLPAPRGQGSLSILCSAVSPVPSVTPSTWMATTEKPELGPAHDAGDNNI
  YEVMPSPVLLVSPISDTRSINPARPLPTPPHLQAEPENHQYQQDLLNPDPAPYCQLVPTS
• Tissue Specificity: Ubiquitous with highest expression in prostate, uterus, fetal brain, mammary gland, adrenal gland, skeletal muscle, small intestine, and kidney, and lower expression in lung, cerebellum, testis, liver, pancreas, bone marrow and ovary.

Molecular Interaction Atlas (MIA) of This DOT

6 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Alzheimer disease	DISF8S70	Strong	Genetic Variation	[1]
Breast cancer	DIS7DPX1	Strong	Altered Expression	[2]
Breast carcinoma	DIS2UE88	Strong	Altered Expression	[2]
Penile cancer	DISGVGNQ	Strong	Altered Expression	[3]
Gastric cancer	DISXGOUK	Limited	Biomarker	[4]
Stomach cancer	DISKIJSX	Limited	Biomarker	[4]

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Carcinoembryonic antigen-related cell adhesion molecule 19 (CEACAM19).	[5]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Carcinoembryonic antigen-related cell adhesion molecule 19 (CEACAM19).	[6]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Carcinoembryonic antigen-related cell adhesion molecule 19 (CEACAM19).	[9]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Carcinoembryonic antigen-related cell adhesion molecule 19 (CEACAM19).	[10]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Carcinoembryonic antigen-related cell adhesion molecule 19 (CEACAM19).	[7]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Carcinoembryonic antigen-related cell adhesion molecule 19 (CEACAM19).	[8]

References

• [1] GWAS on family history of Alzheimer's disease.Transl Psychiatry. 2018 May 18;8(1):99. doi: 10.1038/s41398-018-0150-6.
• [2] High expression of CEACAM19, a new member of carcinoembryonic antigen gene family, in patients with breast cancer.Clin Exp Med. 2017 Nov;17(4):547-553. doi: 10.1007/s10238-016-0442-1. Epub 2016 Dec 1.
• [3] Aberrant CEACAM19 expression is associated with metastatic phenotype in penile cancer.Cancer Manag Res. 2019 Jan 14;11:715-725. doi: 10.2147/CMAR.S192385. eCollection 2019.
• [4] Knockdown of CEACAM19 suppresses human gastric cancer through inhibition of PI3K/Akt and NF-B.Surg Oncol. 2018 Sep;27(3):495-502. doi: 10.1016/j.suronc.2018.05.003. Epub 2018 May 3.
• [5] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [6] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [7] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [8] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [9] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [10] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.