Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTN0GYY8)

DOT Name Putative peptidyl-tRNA hydrolase PTRHD1 (PTRHD1)
Synonyms EC 3.1.1.29; Peptidyl-tRNA hydrolase domain-containing protein 1
Gene Name PTRHD1
Related Disease
Autosomal recessive juvenile Parkinson disease 2 ( )
Intellectual disability ( )
Parkinsonian disorder ( )
UniProt ID
PTRD1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
EC Number
3.1.1.29
Pfam ID
PF01981
Sequence
MHRGVGPAFRVVRKMAASGAEPQVLVQYLVLRKDLSQAPFSWPAGALVAQACHAATAALH
THRDHPHTAAYLQELGRMRKVVLEAPDETTLKELAETLQQKNIDHMLWLEQPENIATCIA
LRPYPKEEVGQYLKKFRLFK

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Autosomal recessive juvenile Parkinson disease 2 DISNSTD1 Strong Genetic Variation [1]
Intellectual disability DISMBNXP moderate Biomarker [2]
Parkinsonian disorder DISHGY45 moderate Biomarker [2]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
3 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Putative peptidyl-tRNA hydrolase PTRHD1 (PTRHD1). [3]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Putative peptidyl-tRNA hydrolase PTRHD1 (PTRHD1). [4]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Putative peptidyl-tRNA hydrolase PTRHD1 (PTRHD1). [5]
------------------------------------------------------------------------------------

References

1 PTRHD1 Loss-of-function mutation in an african family with juvenile-onset Parkinsonism and intellectual disability.Mov Disord. 2018 Nov;33(11):1814-1819. doi: 10.1002/mds.27501. Epub 2018 Nov 6.
2 PTRHD1 and possibly ADORA1 mutations contribute to Parkinsonism with intellectual disability.Mov Disord. 2018 Jan;33(1):174. doi: 10.1002/mds.27126. Epub 2017 Nov 16.
3 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
4 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
5 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.