Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTN0XJZJ)

DOT Name Ribonuclease P protein subunit p29 (POP4)
Synonyms hPOP4
Gene Name POP4
Related Disease
Ovarian cancer ( )
Ovarian neoplasm ( )
Prostate cancer ( )
Prostate carcinoma ( )
UniProt ID
RPP29_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
6AHR; 6AHU
Pfam ID
PF01868
Sequence
MKSVIYHALSQKEANDSDVQPSGAQRAEAFVRAFLKRSTPRMSPQAREDQLQRKAVVLEY
FTRHKRKEKKKKAKGLSARQRRELRLFDIKPEQQRYSLFLPLHELWKQYIRDLCSGLKPD
TQPQMIQAKLLKADLHGAIISVTKSKCPSYVGITGILLQETKHIFKIITKEDRLKVIPKL
NCVFTVETDGFISYIYGSKFQLRSSERSAKKFKAKGTIDL
Function Component of ribonuclease P, a ribonucleoprotein complex that generates mature tRNA molecules by cleaving their 5'-ends.
KEGG Pathway
Ribosome biogenesis in eukaryotes (hsa03008 )
Reactome Pathway
tRNA processing in the nucleus (R-HSA-6784531 )

Molecular Interaction Atlas (MIA) of This DOT

4 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Ovarian cancer DISZJHAP Strong Biomarker [1]
Ovarian neoplasm DISEAFTY Strong Biomarker [1]
Prostate cancer DISF190Y Strong Biomarker [2]
Prostate carcinoma DISMJPLE Strong Biomarker [2]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
3 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of Ribonuclease P protein subunit p29 (POP4). [3]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Ribonuclease P protein subunit p29 (POP4). [5]
Milchsaure DM462BT Investigative Milchsaure decreases the expression of Ribonuclease P protein subunit p29 (POP4). [6]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
TAK-243 DM4GKV2 Phase 1 TAK-243 increases the sumoylation of Ribonuclease P protein subunit p29 (POP4). [4]
------------------------------------------------------------------------------------

References

1 URI is an oncogene amplified in ovarian cancer cells and is required for their survival. Cancer Cell. 2011 Mar 8;19(3):317-32. doi: 10.1016/j.ccr.2011.01.019.
2 Novel biomarkers for prostate cancer including noncoding transcripts.Am J Pathol. 2009 Dec;175(6):2264-76. doi: 10.2353/ajpath.2009.080868. Epub 2009 Nov 5.
3 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
4 Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
5 Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
6 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.