Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTNEPR82)

• DOT Name: PABIR family member 2 (PABIR2)
• Gene Name: PABIR2
• UniProt ID: PBIR2_HUMAN
• Sequence:
  MAQEKMELDLEPDTSYGGTLRRSSSAPLIHGLSDLSQVFQPYTLRTRRNSTTIMSRHSLE
  EGLDMVNRETAHEREMQTAMQISQSWDESLSLSDSDFDKPEKLYSPKRIDFTPVSPAPSP
  TRGFGKMFVSSSGLPPSPVPSPRRFSRRSQSPVKCIRPSVLGPLKRKGEMETESQPKRLF
  QGTTNMLSPDAAQLSDLSSCSDILDGSSSSSGLSSDPLAKGSATAESPVACSNSCSSFIL
  MDDLSPK

Molecular Interaction Atlas (MIA) of This DOT

9 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of PABIR family member 2 (PABIR2).	[1]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of PABIR family member 2 (PABIR2).	[2]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of PABIR family member 2 (PABIR2).	[3]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of PABIR family member 2 (PABIR2).	[4]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide increases the expression of PABIR family member 2 (PABIR2).	[5]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of PABIR family member 2 (PABIR2).	[6]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of PABIR family member 2 (PABIR2).	[8]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of PABIR family member 2 (PABIR2).	[10]
Coumestrol	DM40TBU	Investigative	Coumestrol increases the expression of PABIR family member 2 (PABIR2).	[11]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of PABIR family member 2 (PABIR2).	[7]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 affects the phosphorylation of PABIR family member 2 (PABIR2).	[9]
Coumarin	DM0N8ZM	Investigative	Coumarin affects the phosphorylation of PABIR family member 2 (PABIR2).	[9]

References

• [1] Stem cell transcriptome responses and corresponding biomarkers that indicate the transition from adaptive responses to cytotoxicity. Chem Res Toxicol. 2017 Apr 17;30(4):905-922.
• [2] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [3] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [4] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [5] Oxidative stress modulates theophylline effects on steroid responsiveness. Biochem Biophys Res Commun. 2008 Dec 19;377(3):797-802.
• [6] The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
• [7] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [8] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [9] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [10] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [11] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.