Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTNPDZCN)

• DOT Name: Transcription elongation factor A protein-like 7 (TCEAL7)
• Synonyms: TCEA-like protein 7; Transcription elongation factor S-II protein-like 7
• Gene Name: TCEAL7
• Related Disease:
  B-cell neoplasm
  Advanced cancer
  Endometrial carcinoma
  Epithelial ovarian cancer
  Gastric cancer
  Neoplasm
  Non-small-cell lung cancer
  Ovarian cancer
  Ovarian neoplasm
  Prostate cancer
  Prostate neoplasm
• UniProt ID: TCAL7_HUMAN
• Pfam ID: PF04538
• Sequence:
  MQKPCKENEGKPKCSVPKREEKRPYGEFERQQTEGNFRQRLLQSLEEFKEDIDYRHFKDE
  EMTREGDEMERCLEEIRGLRKKFRALHSNHRHSRDRPYPI
• Function: Plays a role in the negative regulation of NF-kappa-B signaling at the basal level by modulating transcriptional activity of NF-kappa-B on its target gene promoters. Associates with cyclin D1 promoter containing Myc E-box sequence and transcriptionally represses cyclin D1 expression. Regulates telomerase reverse transcriptase expression and telomerase activity in both ALT (alternative lengthening of telomeres)and telomerase-positive cell lines.
• Tissue Specificity: Highly expressed in normal and fetal brain tissues, and weakly expressed in uterus and ovary. Down-regulated in epithelial ovarian, cervical, prostate, breast, brain and lung cancer cell lines and in brain and ovarian tumors.

Molecular Interaction Atlas (MIA) of This DOT

11 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
B-cell neoplasm	DISVY326	Definitive	Altered Expression	[1]
Advanced cancer	DISAT1Z9	Strong	Altered Expression	[2]
Endometrial carcinoma	DISXR5CY	Strong	Altered Expression	[3]
Epithelial ovarian cancer	DIS56MH2	Strong	Altered Expression	[4]
Gastric cancer	DISXGOUK	Strong	Altered Expression	[4]
Neoplasm	DISZKGEW	Strong	Biomarker	[5]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Altered Expression	[4]
Ovarian cancer	DISZJHAP	Strong	Altered Expression	[4]
Ovarian neoplasm	DISEAFTY	Strong	Altered Expression	[4]
Prostate cancer	DISF190Y	Strong	Biomarker	[6]
Prostate neoplasm	DISHDKGQ	Strong	Biomarker	[6]

5 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Transcription elongation factor A protein-like 7 (TCEAL7).	[7]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Transcription elongation factor A protein-like 7 (TCEAL7).	[8]
Cytarabine	DMZD5QR	Approved	Cytarabine increases the expression of Transcription elongation factor A protein-like 7 (TCEAL7).	[9]
Clorgyline	DMCEUJD	Approved	Clorgyline increases the expression of Transcription elongation factor A protein-like 7 (TCEAL7).	[10]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Transcription elongation factor A protein-like 7 (TCEAL7).	[11]

References

• [1] TCEAL7, a putative tumor suppressor gene, negatively regulates NF-kappaB pathway.Oncogene. 2010 Mar 4;29(9):1362-73. doi: 10.1038/onc.2009.431. Epub 2009 Dec 7.
• [2] A role for candidate tumor-suppressor gene TCEAL7 in the regulation of c-Myc activity, cyclin D1 levels and cellular transformation.Oncogene. 2008 Dec 11;27(58):7223-34. doi: 10.1038/onc.2008.360. Epub 2008 Sep 22.
• [3] MicroRNA-182 promotes tumor cell growth by targeting transcription elongation factor A-like 7 in endometrial carcinoma.Cell Physiol Biochem. 2013;32(3):581-90. doi: 10.1159/000354462. Epub 2013 Sep 6.
• [4] Downregulation of TCEAL7 expression induces CCND1 expression in non-small cell lung cancer.Mol Biol Rep. 2019 Oct;46(5):5251-5256. doi: 10.1007/s11033-019-04982-6. Epub 2019 Jul 18.
• [5] Hypoxic Glioma Cell-Secreted Exosomal miR-301a Activates Wnt/-catenin Signaling and Promotes Radiation Resistance by Targeting TCEAL7.Mol Ther. 2019 Nov 6;27(11):1939-1949. doi: 10.1016/j.ymthe.2019.07.011. Epub 2019 Jul 22.
• [6] Microarray comparison of prostate tumor gene expression in African-American and Caucasian American males: a pilot project study.Infect Agent Cancer. 2009 Feb 10;4 Suppl 1(Suppl 1):S3. doi: 10.1186/1750-9378-4-S1-S3.
• [7] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [8] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [9] Cytosine arabinoside induces ectoderm and inhibits mesoderm expression in human embryonic stem cells during multilineage differentiation. Br J Pharmacol. 2011 Apr;162(8):1743-56.
• [10] Anti-oncogenic and pro-differentiation effects of clorgyline, a monoamine oxidase A inhibitor, on high grade prostate cancer cells. BMC Med Genomics. 2009 Aug 20;2:55. doi: 10.1186/1755-8794-2-55.
• [11] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.