Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTO5W4FK)

• DOT Name: Uncharacterized protein CXorf38 (CXORF38)
• Gene Name: CXORF38
• UniProt ID: CX038_HUMAN
• Pfam ID: PF15112
• Sequence:
  MVLSELAARLNCAEYKNWVKAGHCLLLLRSCLQGFVGREVLSFHRGLLAAAPGLGPRAVC
  RGGSRCSPRARQFQPQCQVCAEWKREILRHHVNRNGDVHWGNCRPGRWPVDAWEVAKAFM
  PRGLADKQGPEECDAVALLSLINSCDHFVVDRKKVTEVIKCRNEIMHSSEMKVSSTWLRD
  FQMKIQNFLNEFKNIPEIVAVYSRIEQLLTSDWAVHIPEEDQRDGCECEMGTYLSESQVN
  EIEMQLLKEKLQEIYLQAEEQEVLPEELSNRLEVVKEFLRNNEDLRNGLTEDMQKLDSLC
  LHQKLDSQEPGRQTPDRKA

Molecular Interaction Atlas (MIA) of This DOT

6 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Uncharacterized protein CXorf38 (CXORF38).	[1]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Uncharacterized protein CXorf38 (CXORF38).	[2]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Uncharacterized protein CXorf38 (CXORF38).	[3]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Uncharacterized protein CXorf38 (CXORF38).	[4]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Uncharacterized protein CXorf38 (CXORF38).	[5]
Resorcinol	DMM37C0	Investigative	Resorcinol decreases the expression of Uncharacterized protein CXorf38 (CXORF38).	[9]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Uncharacterized protein CXorf38 (CXORF38).	[6]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the methylation of Uncharacterized protein CXorf38 (CXORF38).	[7]
Coumarin	DM0N8ZM	Investigative	Coumarin increases the phosphorylation of Uncharacterized protein CXorf38 (CXORF38).	[8]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [3] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [4] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [5] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [6] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [7] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [8] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [9] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.