Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTO6GHZU)

DOT Name PTPN13-like protein, Y-linked (PRY)
Synonyms Testis-specific PTP-BL-related Y protein
Gene Name PRY
Related Disease
Prostate cancer ( )
Prostate carcinoma ( )
UniProt ID
PRY_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MGATGLGFLLSWRQDNLNGTDCQGCNILYFSETTGSMCSELSLNRGLEARRKKDLKDSFL
WRYGKVGCISLPLREMTAWINPPQISEIFQGYHQRVHGADALSLQTNSLRSRLSSQCLGQ
SFLLRTLERGRGFRALGDICGHVHEED
Tissue Specificity Expressed in testis. Detected in spermatocytes, spermatids and spermatozoa (at protein level).

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Prostate cancer DISF190Y Limited Posttranslational Modification [1]
Prostate carcinoma DISMJPLE Limited Posttranslational Modification [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of PTPN13-like protein, Y-linked (PRY). [2]
Resveratrol DM3RWXL Phase 3 Resveratrol increases the expression of PTPN13-like protein, Y-linked (PRY). [3]
------------------------------------------------------------------------------------

References

1 DNA methylation regulates the expression of Y chromosome specific genes in prostate cancer.J Urol. 2002 Jan;167(1):335-8.
2 Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
3 Anti-proliferative and gene expression actions of resveratrol in breast cancer cells in vitro. Oncotarget. 2014 Dec 30;5(24):12891-907.