Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTOF9VOU)

• DOT Name: CDKN2AIP N-terminal-like protein (CDKN2AIPNL)
• Synonyms: CDKN2A-interacting protein N-terminal-like protein
• Gene Name: CDKN2AIPNL
• UniProt ID: C2AIL_HUMAN
• Pfam ID: PF11952
• Sequence:
  MVGGEAAAAVEELVSGVRQAADFAEQFRSYSESEKQWKARMEFILRHLPDYRDPPDGSGR
  LDQLLSLSMVWANHLFLGCSYNKDLLDKVMEMADGIEVEDLPQFTTRSELMKKHQS

Molecular Interaction Atlas (MIA) of This DOT

11 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of CDKN2AIP N-terminal-like protein (CDKN2AIPNL).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of CDKN2AIP N-terminal-like protein (CDKN2AIPNL).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of CDKN2AIP N-terminal-like protein (CDKN2AIPNL).	[3]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of CDKN2AIP N-terminal-like protein (CDKN2AIPNL).	[4]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide increases the expression of CDKN2AIP N-terminal-like protein (CDKN2AIPNL).	[5]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of CDKN2AIP N-terminal-like protein (CDKN2AIPNL).	[6]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of CDKN2AIP N-terminal-like protein (CDKN2AIPNL).	[8]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of CDKN2AIP N-terminal-like protein (CDKN2AIPNL).	[9]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of CDKN2AIP N-terminal-like protein (CDKN2AIPNL).	[10]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of CDKN2AIP N-terminal-like protein (CDKN2AIPNL).	[11]
chloropicrin	DMSGBQA	Investigative	chloropicrin increases the expression of CDKN2AIP N-terminal-like protein (CDKN2AIPNL).	[12]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of CDKN2AIP N-terminal-like protein (CDKN2AIPNL).	[7]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [3] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [4] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [5] Oxidative stress modulates theophylline effects on steroid responsiveness. Biochem Biophys Res Commun. 2008 Dec 19;377(3):797-802.
• [6] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [7] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [8] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [9] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [10] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [11] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
• [12] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.