Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTOSTYE2)

• DOT Name: Olfactory receptor 2H2 (OR2H2)
• Synonyms: Hs6M1-12; Olfactory receptor 2H3; Olfactory receptor-like protein FAT11
• Gene Name: OR2H2
• Related Disease: Rheumatoid arthritis
• UniProt ID: OR2H2_HUMAN
• Pfam ID: PF13853
• Sequence:
  MVNQSSTPGFLLLGFSEHPGLERTLFVVVLTSYLLTLVGNTLIILLSALDPKLHSPMYFF
  LSNLSFLDLCFTTSCVPQMLVNLWGPKKTISFLDCSVQIFIFLSLGTTECILLTVMAFDR
  YVAVCQPLHYATIIHPRLCWQLASVAWVIGLVESVVQTPSTLHLPFCPDRQVDDFVCEVP
  ALIRLSCEDTSYNEIQVAVASVFILVVPLSLILVSYGAITWAVLRINSAKGRRKAFGTCS
  SHLTVVTLFYSSVIAVYLQPKNPYAQERGKFFGLFYAVGTPSLNPLIYTLRNKEVTRAFR
  RLLGKEMGLTQS
• Function: Odorant receptor.
• KEGG Pathway: Olfactory transduction (hsa04740)
• Reactome Pathway: Expression and translocation of olfactory receptors (R-HSA-9752946)

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Rheumatoid arthritis	DISTSB4J	Strong	Genetic Variation	[1]

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate affects the expression of Olfactory receptor 2H2 (OR2H2).	[2]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Olfactory receptor 2H2 (OR2H2).	[3]
Amphotericin B	DMTAJQE	Approved	Amphotericin B increases the expression of Olfactory receptor 2H2 (OR2H2).	[4]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane increases the expression of Olfactory receptor 2H2 (OR2H2).	[6]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Olfactory receptor 2H2 (OR2H2).	[5]

References

• [1] REL, encoding a member of the NF-kappaB family of transcription factors, is a newly defined risk locus for rheumatoid arthritis.Nat Genet. 2009 Jul;41(7):820-3. doi: 10.1038/ng.395. Epub 2009 Jun 7.
• [2] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [3] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [4] Differential expression of microRNAs and their predicted targets in renal cells exposed to amphotericin B and its complex with copper (II) ions. Toxicol Mech Methods. 2017 Sep;27(7):537-543. doi: 10.1080/15376516.2017.1333554. Epub 2017 Jun 8.
• [5] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [6] Sulforaphane-induced apoptosis in human leukemia HL-60 cells through extrinsic and intrinsic signal pathways and altering associated genes expression assayed by cDNA microarray. Environ Toxicol. 2017 Jan;32(1):311-328.