Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTPDZ6XV)

• DOT Name: Transcription initiation factor TFIID subunit 7-like (TAF7L)
• Synonyms: Cancer/testis antigen 40; CT40; RNA polymerase II TBP-associated factor subunit Q; TATA box-binding protein-associated factor 50 kDa; Transcription initiation factor TFIID 50 kDa subunit
• Gene Name: TAF7L
• Related Disease:
  Acute myelogenous leukaemia
  Male infertility
  High blood pressure
  Breast cancer
  Breast carcinoma
  Breast neoplasm
• UniProt ID: TAF7L_HUMAN
• Pfam ID: PF04658
• Sequence:
  MECPEGQLPISSENDSTPTVSTSEVTSQQEPQILVDRGSETTYESSADIAGDEGTQIPAD
  EDTQTDADSSAQAAAQAPENFQEGKDMSESQDEVPDEVENQFILRLPLEHACTVRNLARS
  QSVKMKDKLKIDLLPDGRHAVVEVEDVPLAAKLVDLPCVIESLRTLDKKTFYKTADISQM
  LVCTADGDIHLSPEEPAASTDPNIVRKKERGREEKCVWKHGITPPLKNVRKKRFRKTQKK
  VPDVKEMEKSSFTEYIESPDVENEVKRLLRSDAEAVSTRWEVIAEDGTKEIESQGSIPGF
  LISSGMSSHKQGHTSSEYDMLREMFSDSRSNNDDDEDEDDEDEDEDEDEDEDEDKEEEEE
  DCSEEYLERQLQAEFIESGQYRANEGTSSIVMEIQKQIEKKEKKLHKIQNKAQRQKDLIM
  KVENLTLKNHFQSVLEQLELQEKQKNEKLISLQEQLQRFLKK
• Function: Probably functions as a spermatogenesis-specific component of the DNA-binding general transcription factor complex TFIID, a multimeric protein complex that plays a central role in mediating promoter responses to various activators and repressors. May play a role in spermatogenesis.
• Tissue Specificity: Testis-specific.
• KEGG Pathway: Basal transcription factors (hsa03022)
• Reactome Pathway:
  RNA Polymerase II HIV Promoter Escape (R-HSA-167162)
  Transcription of the HIV genome (R-HSA-167172)
  RNA Polymerase II Pre-transcription Events (R-HSA-674695)
  Regulation of TP53 Activity through Phosphorylation (R-HSA-6804756)
  RNA Polymerase II Promoter Escape (R-HSA-73776)
  RNA Polymerase II Transcription Pre-Initiation And Promoter Opening (R-HSA-73779)
  RNA Polymerase II Transcription Initiation (R-HSA-75953)
  RNA Polymerase II Transcription Initiation And Promoter Clearance (R-HSA-76042)
  HIV Transcription Initiation (R-HSA-167161)

Molecular Interaction Atlas (MIA) of This DOT

6 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Acute myelogenous leukaemia	DISCSPTN	Definitive	Altered Expression	[1]
Male infertility	DISY3YZZ	Strong	Genetic Variation	[2]
High blood pressure	DISY2OHH	moderate	Biomarker	[3]
Breast cancer	DIS7DPX1	Limited	Biomarker	[4]
Breast carcinoma	DIS2UE88	Limited	Biomarker	[4]
Breast neoplasm	DISNGJLM	Limited	Altered Expression	[4]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Transcription initiation factor TFIID subunit 7-like (TAF7L).	[5]

References

• [1] Expression analysis of four testis-specific genes AURKC, OIP5, PIWIL2 and TAF7L in acute myeloid leukemia: a gender-dependent expression pattern.Med Oncol. 2013 Mar;30(1):368. doi: 10.1007/s12032-012-0368-8. Epub 2013 Jan 6.
• [2] The role of the testis-specific gene hTAF7L in the aetiology of male infertility.Mol Hum Reprod. 2006 Apr;12(4):263-7. doi: 10.1093/molehr/gal020. Epub 2006 Apr 5.
• [3] Simultaneous validation of the SunTech CT40 automated blood pressure measurement device by the 1993 British Hypertension Society protocol and the Association for the Advancement of Medical Instrumentation/International Organization for Standardization 81060-2: 2013 standard.Blood Press Monit. 2017 Oct;22(5):298-301. doi: 10.1097/MBP.0000000000000281.
• [4] Cancer/Testis OIP5 and TAF7L Genes are Up-Regulated in Breast Cancer.Asian Pac J Cancer Prev. 2015;16(11):4623-8. doi: 10.7314/apjcp.2015.16.11.4623.
• [5] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.