Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTPFLB1R)

DOT Name Transmembrane protein 196 (TMEM196)
Gene Name TMEM196
Related Disease
Advanced cancer ( )
Asthma ( )
Ataxia-telangiectasia ( )
Lung cancer ( )
Lung carcinoma ( )
Lung neoplasm ( )
Neoplasm ( )
Respiratory disease ( )
UniProt ID
TM196_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MCTSGQIIGSLLVLSVLEIGLGVSSVAVGAVSFSLALREHKPQLGDSSPVWSGVCFLLCG
ICGILCAKKKSGLVMILFSACCICGLIGGILNFQFLRAVTKKTSSLYPLHLASMSLACIG
IGGCTLSSWLTCRLASYEQRRMFSEREHSLHHSHEMAEKEITDNMSNGGPQLIFNGRV
Function
Acts as a tumor suppressor in lung cancer. Inhibits tumor cell growth by inhibiting cell proliferation and migration and promoting cell apoptosis. Inhibits metastasis of lung cancer by suppressing beta-catenin expression in the Wnt/beta-catenin signaling pathway.
Tissue Specificity Expression is significantly decreased in lung cancer cells compared to normal lung tissue (at protein level).

Molecular Interaction Atlas (MIA) of This DOT

8 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Advanced cancer DISAT1Z9 Strong Biomarker [1]
Asthma DISW9QNS Strong Genetic Variation [2]
Ataxia-telangiectasia DISP3EVR Strong Genetic Variation [2]
Lung cancer DISCM4YA Strong Posttranslational Modification [1]
Lung carcinoma DISTR26C Strong Posttranslational Modification [1]
Lung neoplasm DISVARNB Strong Posttranslational Modification [3]
Neoplasm DISZKGEW Strong Altered Expression [1]
Respiratory disease DISGGAGJ Strong Genetic Variation [2]
------------------------------------------------------------------------------------
⏷ Show the Full List of 8 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of Transmembrane protein 196 (TMEM196). [4]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Transmembrane protein 196 (TMEM196). [5]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the expression of Transmembrane protein 196 (TMEM196). [6]
------------------------------------------------------------------------------------

References

1 TMEM196 hypermethylation as a novel diagnostic and prognostic biomarker for lung cancer.Mol Carcinog. 2019 Apr;58(4):474-487. doi: 10.1002/mc.22942. Epub 2018 Dec 11.
2 Associations between TMEM196 polymorphisms and NSAID-exacerbated respiratory disease in asthma.Pharmacogenet Genomics. 2019 Jun;29(4):69-75. doi: 10.1097/FPC.0000000000000367.
3 TMEM196 acts as a novel functional tumour suppressor inactivated by DNA methylation and is a potential prognostic biomarker in lung cancer.Oncotarget. 2015 Aug 28;6(25):21225-39. doi: 10.18632/oncotarget.4237.
4 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
5 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
6 Transcriptomic?pathway?and?benchmark dose analysis of Bisphenol A, Bisphenol S, Bisphenol F, and 3,3',5,5'-Tetrabromobisphenol A in H9 human embryonic stem cells. Toxicol In Vitro. 2021 Apr;72:105097. doi: 10.1016/j.tiv.2021.105097. Epub 2021 Jan 18.