Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTPT639J)

• DOT Name: Forkhead box protein J2 (FOXJ2)
• Synonyms: Fork head homologous X
• Gene Name: FOXJ2
• UniProt ID: FOXJ2_HUMAN
• Pfam ID: PF00250
• Sequence:
  MASDLESSLTSIDWLPQLTLRATIEKLGSASQAGPPGSSRKCSPGSPTDPNATLSKDEAA
  VHQDGKPRYSYATLITYAINSSPAKKMTLSEIYRWICDNFPYYKNAGIGWKNSIRHNLSL
  NKCFRKVPRPRDDPGKGSYWTIDTCPDISRKRRHPPDDDLSQDSPEQEASKSPRGGVAGS
  GEASLPPEGNPQMSLQSPTSIASYSQGTGSVDGGAVAAGASGRESAEGPPPLYNTNHDFK
  FSYSEINFQDLSWSFRNLYKSMLEKSSSSSQHGFSSLLGDIPPSNNYYMYQQQQPPPPQQ
  QQQQQQPPQPPPQQSQPQQQQAPAQGPSAVGGAPPLHTPSTDGCTPPGGKQAGAEGYGPP
  PVMAMHPPPLQHGGYHPHQHHPHSHPAQQPPPPQPQAQGQAPINNTGFAFPSDWCSNIDS
  LKESFKMVNRLNWSSIEQSQFSELMESLRQAEQKNWTLDQHHIANLCDSLNHFLTQTGHV
  PPQGGTHRPPAPARIADSCALTSGKQESAMSQVNSYGHPQAPHLYPGPSPMYPIPTQDSA
  GYNRPAHHMVPRPSVPPPGANEEIPDDFDWDLIT
• Function: [Isoform FOXJ2.L]: Transcriptional activator. Able to bind to two different type of DNA binding sites. More effective than isoform FOXJ2.S in transcriptional activation. Plays an important role in spermatogenesis, especially in spermatocyte meiosis; [Isoform FOXJ2.S]: Transcriptional activator.
• Tissue Specificity: Widely expressed.

Molecular Interaction Atlas (MIA) of This DOT

9 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Forkhead box protein J2 (FOXJ2).	[1]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Forkhead box protein J2 (FOXJ2).	[2]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Forkhead box protein J2 (FOXJ2).	[3]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Forkhead box protein J2 (FOXJ2).	[4]
Etoposide	DMNH3PG	Approved	Etoposide decreases the expression of Forkhead box protein J2 (FOXJ2).	[4]
Mitomycin	DMH0ZJE	Approved	Mitomycin decreases the expression of Forkhead box protein J2 (FOXJ2).	[4]
Colchicine	DM2POTE	Approved	Colchicine decreases the expression of Forkhead box protein J2 (FOXJ2).	[4]
Hydroxyurea	DMOQVU9	Approved	Hydroxyurea decreases the expression of Forkhead box protein J2 (FOXJ2).	[4]
Adenine	DMZLHKJ	Approved	Adenine decreases the expression of Forkhead box protein J2 (FOXJ2).	[4]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 increases the phosphorylation of Forkhead box protein J2 (FOXJ2).	[5]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Forkhead box protein J2 (FOXJ2).	[6]

References

• [1] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [2] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [3] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [4] Utilization of CDKN1A/p21 gene for class discrimination of DNA damage-induced clastogenicity. Toxicology. 2014 Jan 6;315:8-16. doi: 10.1016/j.tox.2013.10.009. Epub 2013 Nov 6.
• [5] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [6] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.