Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTQ7EMPU)

DOT Name	Neuron-specific vesicular protein calcyon (CALY)
Gene Name	CALY
UniProt ID	CALY_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF06387
Sequence	MVKLGCSFSGKPGKDPGDQDGAAMDSVPLISPLDISQLQPPLPDQVVIKTQTEYQLSSPD QQNFPDLEGQRLNCSHPEEGRRLPTARMIAFAMALLGCVLIMYKAIWYDQFTCPDGFLLR HKICTPLTLEMYYTEMDPERHRSILAAIGAYPLSRKHGTETPAAWGDGYRAAKEERKGPT QAGAAAAATEPPGKPSAKAEKEAARKAAGSAAPPPAQ
Function	Interacts with clathrin light chain A and stimulates clathrin self-assembly and clathrin-mediated endocytosis.
Tissue Specificity	Expressed in the pyramidal cells of the prefrontal cortex, in hypothalamus and in caudate nucleus. No expression in spleen. Up-regulated in the prefrontal cortex of schizophrenic patients with nearly twice the levels of non-schizophrenics.
KEGG Pathway	Dopaminergic sy.pse (hsa04728 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

This DOT Affected the Regulation of Drug Effects of 3 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Dopamine	DMPGUCF	Approved	Neuron-specific vesicular protein calcyon (CALY) decreases the secretion of Dopamine.	[4]
Epinephrine	DM3KJBC	Approved	Neuron-specific vesicular protein calcyon (CALY) decreases the secretion of Epinephrine.	[4]
Norepinephrine	DMOUC09	Approved	Neuron-specific vesicular protein calcyon (CALY) increases the secretion of Norepinephrine.	[4]
------------------------------------------------------------------------------------

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Sodium chloride	DMM3950	Approved	Neuron-specific vesicular protein calcyon (CALY) increases the response to substance of Sodium chloride.	[4]
------------------------------------------------------------------------------------

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Neuron-specific vesicular protein calcyon (CALY).	[1]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Neuron-specific vesicular protein calcyon (CALY).	[3]
------------------------------------------------------------------------------------

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Neuron-specific vesicular protein calcyon (CALY).	[2]
------------------------------------------------------------------------------------

References

1	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
2	Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
3	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
4	Increased arterial pressure in mice with overexpression of the ADHD candidate gene calcyon in forebrain. PLoS One. 2019 Feb 12;14(2):e0211903. doi: 10.1371/journal.pone.0211903. eCollection 2019.