Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTQ7V4FF)

• DOT Name: CUE domain-containing protein 1 (CUEDC1)
• Gene Name: CUEDC1
• Related Disease:
  Breast cancer
  Breast carcinoma
• UniProt ID: CUED1_HUMAN
• PDB ID: 2DHY
• Pfam ID: PF02845
• Sequence:
  MTSLFRRSSSGSGGGGTAGARGGGGGTAAPQELNNSRPARQVRRLEFNQAMDDFKTMFPN
  MDYDIIECVLRANSGAVDATIDQLLQMNLEGGGSSGGVYEDSSDSEDSIPPEILERTLEP
  DSSDEEPPPVYSPPAYHMHVFDRPYPLAPPTPPPRIDALGSGAPTSQRRYRNWNPPLLGN
  LPDDFLRILPQQLDSIQGNAGGPKPGSGEGCPPAMAGPGPGDQESRWKQYLEDERIALFL
  QNEEFMKELQRNRDFLLALERDRLKYESQKSKSSSVAVGNDFGFSSPVPGTGDANPAVSE
  DALFRDKLKHMGKSTRRKLFELARAFSEKTKMRKSKRKHLLKHQSLGAAASTANLLDDVE
  GHACDEDFRGRRQEAPKVEEGLREGQ

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Breast cancer	DIS7DPX1	Strong	Biomarker	[1]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[1]

6 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate affects the expression of CUE domain-containing protein 1 (CUEDC1).	[2]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of CUE domain-containing protein 1 (CUEDC1).	[3]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of CUE domain-containing protein 1 (CUEDC1).	[4]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of CUE domain-containing protein 1 (CUEDC1).	[5]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of CUE domain-containing protein 1 (CUEDC1).	[6]
Marinol	DM70IK5	Approved	Marinol increases the expression of CUE domain-containing protein 1 (CUEDC1).	[7]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Fulvestrant	DM0YZC6	Approved	Fulvestrant increases the methylation of CUE domain-containing protein 1 (CUEDC1).	[8]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of CUE domain-containing protein 1 (CUEDC1).	[9]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the methylation of CUE domain-containing protein 1 (CUEDC1).	[8]

References

• [1] CUEDC1 is a primary target of ER essential for the growth of breast cancer cells.Cancer Lett. 2018 Nov 1;436:87-95. doi: 10.1016/j.canlet.2018.08.018. Epub 2018 Aug 23.
• [2] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [3] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [4] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [5] High-throughput ectopic expression screen for tamoxifen resistance identifies an atypical kinase that blocks autophagy. Proc Natl Acad Sci U S A. 2011 Feb 1;108(5):2058-63.
• [6] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [7] THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
• [8] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [9] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.