Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTQY73YS)

DOT Name	Late cornified envelope protein 1C (LCE1C)
Synonyms	Late envelope protein 3
Gene Name	LCE1C
Related Disease	High blood pressure ( ) Obesity ( )
UniProt ID	LCE1C_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF14672
Sequence	MSCQQSQQQCQPPPKCTPKCPPKCPTPKCPPKCPPKCPPVSSCCSVSSGGCCGSSSGGSC GSSSGGCCSSGGGGCCLSHHRRRRSHCHRPQSSGCCSQPSGGSSCCGGGSGQHSGGCC
Function	Precursors of the cornified envelope of the stratum corneum.
Tissue Specificity	Skin-specific. Expression was readily detected in adult trunk skin, adult arm skin, fetal skin, penal skin, vulva, esophagus and tongue. Not expressed in the cervix, rectum, lung, colon, or placenta.
Reactome Pathway	Formation of the cornified envelope (R-HSA-6809371 )

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
High blood pressure	DISY2OHH	Strong	Biomarker	[1]
Obesity	DIS47Y1K	Limited	Genetic Variation	[2]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Late cornified envelope protein 1C (LCE1C).	[3]
------------------------------------------------------------------------------------

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Late cornified envelope protein 1C (LCE1C).	[4]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Late cornified envelope protein 1C (LCE1C).	[5]
------------------------------------------------------------------------------------

References

1	LEP 3'HVR is associated with obesity and leptin levels in Brazilian individuals.Mol Genet Metab. 2006 Dec;89(4):374-80. doi: 10.1016/j.ymgme.2006.04.012. Epub 2006 Jun 9.
2	Leptin and Leptin receptor polymorphisms, plasma Leptin levels and obesity in Tunisian volunteers.Int J Exp Pathol. 2018 Jun;99(3):121-130. doi: 10.1111/iep.12271. Epub 2018 Jun 11.
3	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
4	Regulation of chromatin assembly and cell transformation by formaldehyde exposure in human cells. Environ Health Perspect. 2017 Sep 21;125(9):097019.
5	Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.