Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTRA5CHY)

• DOT Name: Glycoprotein integral membrane protein 1 (GINM1)
• Gene Name: GINM1
• UniProt ID: GINM1_HUMAN
• Sequence:
  MEGAPPGSLALRLLLFVALPASGWLTTGAPEPPPLSGAPQDGIRINVTTLKDDGDISKQQ
  VVLNITYESGQVYVNDLPVNSGVTRISCQTLIVKNENLENLEEKEYFGIVSVRILVHEWP
  MTSGSSLQLIVIQEEVVEIDGKQVQQKDVTEIDILVKNRGVLRHSNYTLPLEESMLYSIS
  RDSDILFTLPNLSKKESVSSLQTTSQYLIRNVETTVDEDVLPGKLPETPLRAEPPSSYKV
  MCQWMEKFRKDLCRFWSNVFPVFFQFLNIMVVGITGAAVVITILKVFFPVSEYKGILQLD
  KVDVIPVTAINLYPDGPEKRAENLEDKTCI

Molecular Interaction Atlas (MIA) of This DOT

5 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Glycoprotein integral membrane protein 1 (GINM1).	[1]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Glycoprotein integral membrane protein 1 (GINM1).	[2]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Glycoprotein integral membrane protein 1 (GINM1).	[3]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Glycoprotein integral membrane protein 1 (GINM1).	[4]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Glycoprotein integral membrane protein 1 (GINM1).	[5]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [3] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [4] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [5] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.