Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTREOQBO)

DOT Name Pleckstrin homology domain-containing family H member 3 (PLEKHH3)
Synonyms PH domain-containing family H member 3
Gene Name PLEKHH3
Related Disease
Prostate cancer ( )
Prostate carcinoma ( )
UniProt ID
PKHH3_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00373 ; PF00784 ; PF00788
Sequence
MPLPGGLWWLLCCRRGFTLLHRDYGDGELSGDGDEDEDEETFELRTPSPAGGGRGPLEVT
LTQPVRSGPVSNRLQSWEETWSLIPEKGLPEDDPDIVVKGWLYREPRGGGARPWLPPRRA
WFVLTRDSLDQFSSSGKGARRLGSLVLTSLCSVTGPERRRKETGLWSVTVSGRKHSVRLC
SPRQAEAERWGVALREVIASKAPLETPTQLLLRDIQESCGDPEAVALIYLRNPILRHTSG
ALYAPLLPLPYGVSAPGPGYAPLREEAVRLFLALQALEGARRPGPLMQGVLQTCRDLPAL
RDELFLQLAKQTSGPAGPPGLPATQDPAALRYWQLLTCMSCTFRPGGAVRGHLLGHLERT
EQALPDSELAEYARFIRKALGRTRGRELVPSLAEISALSQRQELLCTVHCPGAGACAVAI
DSHTTAGEVARELVGRLGLARSRNAFALYEQRGAQERALAGGTLVADVLTRFENLAAEEA
GLEDSPDSGWRLCLRLHGPLHPEGLSPDGHELPFLFEQAHALLLRGRPPPPDDTLRALAA
LRLQSLQRDFSPRVPLPRLDRLLPPPAPPREDPPRPTPRPPPSAALLAGALWSPGLAKRR
AERARRGGAGRTAGSIAREGGGGAGTAAAVLGGWKRLRGMGRAEAMAAYLALAAQCPGFG
AARYDVLELSTEPGRGAPQKLCLGLGAKAMSLSRPGETEPIHSVSYGHVAACQLMGPHTL
ALRVGESQLLLQSPQVEEIMQLVNAYLANPSPERPCSSSSPPCQDLPDTSPPSQRPGLDE
PQGQSGCLGQLQD

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Prostate cancer DISF190Y Definitive Biomarker [1]
Prostate carcinoma DISMJPLE Definitive Biomarker [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Pleckstrin homology domain-containing family H member 3 (PLEKHH3). [2]
Fulvestrant DM0YZC6 Approved Fulvestrant increases the methylation of Pleckstrin homology domain-containing family H member 3 (PLEKHH3). [5]
------------------------------------------------------------------------------------
6 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of Pleckstrin homology domain-containing family H member 3 (PLEKHH3). [3]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of Pleckstrin homology domain-containing family H member 3 (PLEKHH3). [4]
Irinotecan DMP6SC2 Approved Irinotecan increases the expression of Pleckstrin homology domain-containing family H member 3 (PLEKHH3). [6]
Urethane DM7NSI0 Phase 4 Urethane increases the expression of Pleckstrin homology domain-containing family H member 3 (PLEKHH3). [7]
THAPSIGARGIN DMDMQIE Preclinical THAPSIGARGIN increases the expression of Pleckstrin homology domain-containing family H member 3 (PLEKHH3). [8]
Formaldehyde DM7Q6M0 Investigative Formaldehyde decreases the expression of Pleckstrin homology domain-containing family H member 3 (PLEKHH3). [9]
------------------------------------------------------------------------------------
⏷ Show the Full List of 6 Drug(s)

References

1 Searching for candidate genes in familial BRCAX mutation carriers with prostate cancer.Urol Oncol. 2016 Mar;34(3):120.e9-16. doi: 10.1016/j.urolonc.2015.10.009. Epub 2015 Nov 14.
2 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
3 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
4 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
5 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
6 In vitro and in vivo irinotecan-induced changes in expression profiles of cell cycle and apoptosis-associated genes in acute myeloid leukemia cells. Mol Cancer Ther. 2005 Jun;4(6):885-900.
7 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
8 Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
9 Cellular reactions to long-term volatile organic compound (VOC) exposures. Sci Rep. 2016 Dec 1;6:37842. doi: 10.1038/srep37842.