Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTRF2MC9)

• DOT Name: RNA-binding motif protein, X-linked-like-2 (RBMXL2)
• Synonyms: Testis-specific heterogeneous nuclear ribonucleoprotein G-T; hnRNP G-T
• Gene Name: RBMXL2
• Related Disease: Male infertility
• UniProt ID: RMXL2_HUMAN
• Pfam ID: PF08081 ; PF00076
• Sequence:
  MVEADRPGKLFIGGLNLETDEKALEAEFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPA
  DAKAAARDMNGKSLDGKAIKVAQATKPAFESSRRGPPPPRSRGRPRFLRGTRGGGGGPRR
  SPSRGGPDDDGGYTADFDLRPSRAPMPMKRGPPPRRVGPPPKRAAPSGPARSSGGGMRGR
  ALAVRGRDGYSGPPRREPLPPRRDPYLGPRDEGYSSRDGYSSRDYREPRGFAPSPGEYTH
  RDYGHSSVRDDCPLRGYSDRDGYGGRDRDYGDHLSRGSHREPFESYGELRGAAPGRGTPP
  SYGGGGRYEEYRGYSPDAYSGGRDSYSSSYGRSDRYSRGRHRVGRPDRGLSLSMERGCPP
  QRDSYSRSGCRVPRGGGRLGGRLERGGGRSRY
• Tissue Specificity: Expressed predominantly in spermatocytes and less in round spermatids (at protein level). Expressed in germ cells.

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Male infertility	DISY3YZZ	Strong	Altered Expression	[1]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of RNA-binding motif protein, X-linked-like-2 (RBMXL2).	[2]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of RNA-binding motif protein, X-linked-like-2 (RBMXL2).	[4]

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Permethrin	DMZ0Q1G	Approved	Permethrin decreases the expression of RNA-binding motif protein, X-linked-like-2 (RBMXL2).	[3]

References

• [1] Haploinsufficiency of the germ cell-specific nuclear RNA binding protein hnRNP G-T prevents functional spermatogenesis in the mouse.Hum Mol Genet. 2008 Sep 15;17(18):2803-18. doi: 10.1093/hmg/ddn179. Epub 2008 Jun 18.
• [2] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [3] Exposure to Insecticides Modifies Gene Expression and DNA Methylation in Hematopoietic Tissues In Vitro. Int J Mol Sci. 2023 Mar 26;24(7):6259. doi: 10.3390/ijms24076259.
• [4] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.