Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTS6ECUM)

DOT Name Uncharacterized protein C15orf61 (C15ORF61)
Gene Name C15ORF61
UniProt ID
CO061_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF15031
Sequence
MEALRRAHEVALRLLLCRPWASRAAARPKPSASEVLTRHLLQRRLPHWTSFCVPYSAVRN
DQFGLSHFNWPVQGANYHVLRTGCFPFIKYHCSKAPWQDLARQNRFFTALKVVNLGIPTL
LYGLGSWLFARVTETVHTSYGPITVYFLNKEDEGAMY

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
8 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Uncharacterized protein C15orf61 (C15ORF61). [1]
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of Uncharacterized protein C15orf61 (C15ORF61). [2]
Tretinoin DM49DUI Approved Tretinoin increases the expression of Uncharacterized protein C15orf61 (C15ORF61). [3]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Uncharacterized protein C15orf61 (C15ORF61). [4]
Temozolomide DMKECZD Approved Temozolomide increases the expression of Uncharacterized protein C15orf61 (C15ORF61). [5]
Carbamazepine DMZOLBI Approved Carbamazepine affects the expression of Uncharacterized protein C15orf61 (C15ORF61). [6]
Trichostatin A DM9C8NX Investigative Trichostatin A decreases the expression of Uncharacterized protein C15orf61 (C15ORF61). [7]
Formaldehyde DM7Q6M0 Investigative Formaldehyde decreases the expression of Uncharacterized protein C15orf61 (C15ORF61). [8]
------------------------------------------------------------------------------------
⏷ Show the Full List of 8 Drug(s)

References

1 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
2 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
3 Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
4 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
5 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
6 Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
7 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
8 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.