Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTSIWJQJ)

DOT Name	Pre-rRNA-processing protein TSR2 homolog (TSR2)
Gene Name	TSR2
Related Disease	Diamond-Blackfan anemia 6 ( ) Laryngeal squamous cell carcinoma ( ) Diamond-Blackfan anemia ( ) Diamond-Blackfan anemia 14 with mandibulofacial dysostosis ( ) Neoplasm ( )
UniProt ID	TSR2_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF10273
Sequence	MAGAAEDARALFRAGVCAALEAWPALQIAVENGFGGVHSQEKAKWLGGAVEDYFMRNADL ELDEVEDFLGELLTNEFDTVVEDGSLPQVSQQLQTMFHHFQRGDGAALREMASCITQRKC KVTATALKTARETDEDEDDVDSVEEMEVTATNDGAATDGVCPQPEPSDPDAQTIKEEDIV EDGWTIVRRKK
Function	May be involved in 20S pre-rRNA processing.

Molecular Interaction Atlas (MIA) of This DOT

5 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Diamond-Blackfan anemia 6	DIS4FKKF	Definitive	GermlineCausalMutation	[1]
Laryngeal squamous cell carcinoma	DIS9UUVF	moderate	Altered Expression	[2]
Diamond-Blackfan anemia	DISI2SNW	Supportive	Autosomal dominant	[1]
Diamond-Blackfan anemia 14 with mandibulofacial dysostosis	DIST4TJ4	Limited	X-linked	[1]
Neoplasm	DISZKGEW	Limited	Biomarker	[3]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Pre-rRNA-processing protein TSR2 homolog (TSR2).	[4]
Diethylstilbestrol	DMN3UXQ	Approved	Diethylstilbestrol decreases the expression of Pre-rRNA-processing protein TSR2 homolog (TSR2).	[5]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Pre-rRNA-processing protein TSR2 homolog (TSR2).	[7]
------------------------------------------------------------------------------------

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Pre-rRNA-processing protein TSR2 homolog (TSR2).	[6]
------------------------------------------------------------------------------------

References

1	Diamond-Blackfan anemia with mandibulofacial dystostosis is heterogeneous, including the novel DBA genes TSR2 and RPS28. Am J Med Genet A. 2014 Sep;164A(9):2240-9. doi: 10.1002/ajmg.a.36633. Epub 2014 Jun 18.
2	TSR2 Induces laryngeal cancer cell apoptosis through inhibiting NF-B signaling pathway.Laryngoscope. 2018 Apr;128(4):E130-E134. doi: 10.1002/lary.27035. Epub 2017 Dec 27.
3	Expression of the type-1 repeats of thrombospondin-1 inhibits tumor growth through activation of transforming growth factor-beta.Am J Pathol. 2004 Aug;165(2):541-52. doi: 10.1016/s0002-9440(10)63319-6.
4	Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
5	Identification of biomarkers and outcomes of endocrine disruption in human ovarian cortex using In Vitro Models. Toxicology. 2023 Feb;485:153425. doi: 10.1016/j.tox.2023.153425. Epub 2023 Jan 5.
6	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
7	Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.