Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTSJXAEJ)

• DOT Name: Transcription elongation factor A N-terminal and central domain-containing protein 2 (TCEANC2)
• Gene Name: TCEANC2
• Related Disease: Parkinson disease
• UniProt ID: TEAN2_HUMAN
• Pfam ID: PF08711
• Sequence:
  MDKFVIRTPRIQNSPQKKDSGGKVYKQATIESLKRVVVVEDIKRWKTMLELPDQTKENLV
  EALQELKKKIPSREVLKSTRIGHTVNKMRKHSDSEVASLAREVYTEWKTFTEKHSNRPSI
  EVRSDPKTESLRKNAQKLLSEALELKMDHLLVENIERETFHLCSRLINGPYRRTVRALVF
  TLKHRAEIRAQVKSGSLPVGTFVQTHKK

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Parkinson disease	DISQVHKL	Limited	Genetic Variation	[1]

5 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Transcription elongation factor A N-terminal and central domain-containing protein 2 (TCEANC2).	[2]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Transcription elongation factor A N-terminal and central domain-containing protein 2 (TCEANC2).	[3]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Transcription elongation factor A N-terminal and central domain-containing protein 2 (TCEANC2).	[4]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Transcription elongation factor A N-terminal and central domain-containing protein 2 (TCEANC2).	[5]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the expression of Transcription elongation factor A N-terminal and central domain-containing protein 2 (TCEANC2).	[6]

References

• [1] PARK10 is a major locus for sporadic neuropathologically confirmed Parkinson disease.Neurology. 2015 Mar 10;84(10):972-80. doi: 10.1212/WNL.0000000000001332. Epub 2015 Feb 6.
• [2] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [3] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [4] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [5] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [6] Benzo[a]pyrene-induced changes in microRNA-mRNA networks. Chem Res Toxicol. 2012 Apr 16;25(4):838-49.