Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTSKB02R)

• DOT Name: Serine-rich and transmembrane domain-containing protein 1 (SERTM1)
• Gene Name: SERTM1
• UniProt ID: SRTM1_HUMAN
• Pfam ID: PF15872
• Sequence:
  MSEPDTSSGFSGSVENGTFLELFPTSLSTSVDPSSGHLSNVYIYVSIFLSLLAFLLLLLI
  IALQRLKNIISSSSSYPEYPSDAGSSFTNLEVCSISSQRSTFSNLSS

Molecular Interaction Atlas (MIA) of This DOT

7 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Serine-rich and transmembrane domain-containing protein 1 (SERTM1).	[1]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Serine-rich and transmembrane domain-containing protein 1 (SERTM1).	[3]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Serine-rich and transmembrane domain-containing protein 1 (SERTM1).	[4]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Serine-rich and transmembrane domain-containing protein 1 (SERTM1).	[5]
Folic acid	DMEMBJC	Approved	Folic acid increases the expression of Serine-rich and transmembrane domain-containing protein 1 (SERTM1).	[6]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Serine-rich and transmembrane domain-containing protein 1 (SERTM1).	[8]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Serine-rich and transmembrane domain-containing protein 1 (SERTM1).	[9]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the methylation of Serine-rich and transmembrane domain-containing protein 1 (SERTM1).	[2]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Serine-rich and transmembrane domain-containing protein 1 (SERTM1).	[7]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
• [3] Identification of transcriptome signatures and biomarkers specific for potential developmental toxicants inhibiting human neural crest cell migration. Arch Toxicol. 2016 Jan;90(1):159-80.
• [4] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [5] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [6] Folic acid supplementation dysregulates gene expression in lymphoblastoid cells--implications in nutrition. Biochem Biophys Res Commun. 2011 Sep 9;412(4):688-92. doi: 10.1016/j.bbrc.2011.08.027. Epub 2011 Aug 16.
• [7] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [8] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [9] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.