Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTSYU3S9)

• DOT Name: Small integral membrane protein 24 (SMIM24)
• Gene Name: SMIM24
• UniProt ID: SIM24_HUMAN
• Pfam ID: PF15807
• Sequence:
  METLGALLVLEFLLLSPVEAQQATEHRLKPWLVGLAAVVGFLFIVYLVLLANRLWCSKAR
  AEDEEETTFRMESNLYQDQSEDKREKKEAKEKEEKRKKEKKTAKEGESNLGLDLEEKEPG
  DHERAKSTVM

Molecular Interaction Atlas (MIA) of This DOT

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Small integral membrane protein 24 (SMIM24).	[1]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Small integral membrane protein 24 (SMIM24).	[7]

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Small integral membrane protein 24 (SMIM24).	[2]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Small integral membrane protein 24 (SMIM24).	[2]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Small integral membrane protein 24 (SMIM24).	[3]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of Small integral membrane protein 24 (SMIM24).	[4]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Small integral membrane protein 24 (SMIM24).	[5]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Small integral membrane protein 24 (SMIM24).	[6]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide decreases the expression of Small integral membrane protein 24 (SMIM24).	[8]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A affects the expression of Small integral membrane protein 24 (SMIM24).	[9]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [3] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [4] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [5] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [6] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [7] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [8] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [9] Comprehensive analysis of transcriptomic changes induced by low and high doses of bisphenol A in HepG2 spheroids in vitro and rat liver in vivo. Environ Res. 2019 Jun;173:124-134. doi: 10.1016/j.envres.2019.03.035. Epub 2019 Mar 18.