Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTTG4S9O)

• DOT Name: Methyl-CpG-binding domain protein 3-like 2 (MBD3L2)
• Synonyms: MBD3-like protein 2
• Gene Name: MBD3L2
• Related Disease:
  Gastric cancer
  Gastric neoplasm
  Hereditary diffuse gastric adenocarcinoma
• UniProt ID: MB3L2_HUMAN
• Pfam ID: PF14048 ; PF16564
• Sequence:
  MGEPAFTSFPSLPVLGKLKRNMMPWALQKKREIHMAKAHRRRAARSALPMRLTSCIFRRP
  VTRIRSHPDNQVRRRKGDEHLEKPQQLCAYRRLQALQPCSSQGEGSSPLHLESVLSILAP
  GTAGESLDRAGAERVRSPLEPTPGRFPAVAGGPTPGMGCQLPPPLSGQLVTPADIRRQAR
  RVKKARERLAKALQADRLARRAEMLTGG
• Function: May displace the NuRD complex from chromatin.
• Tissue Specificity: Detected at low levels in several somatic tissues . Highly expressed in the ovarian teratocarcinoma cell line PA-1 .

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Gastric cancer	DISXGOUK	Limited	Biomarker	[1]
Gastric neoplasm	DISOKN4Y	Limited	Biomarker	[1]
Hereditary diffuse gastric adenocarcinoma	DISUIBYS	Limited	Biomarker	[1]

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Decitabine	DMQL8XJ	Approved	Decitabine increases the expression of Methyl-CpG-binding domain protein 3-like 2 (MBD3L2).	[1]

References

• [1] Chemical genomic screening for methylation-silenced genes in gastric cancer cell lines using 5-aza-2'-deoxycytidine treatment and oligonucleotide microarray. Cancer Sci. 2006 Jan;97(1):64-71.
• [2] Chemical genomic screening for methylation-silenced genes in gastric cancer cell lines using 5-aza-2'-deoxycytidine treatment and oligonucleotide microarray. Cancer Sci. 2006 Jan;97(1):64-71.