Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTTK7M0R)

• DOT Name: Keratin-like protein KRT222 (KRT222)
• Synonyms: Keratin-222; Keratin-222 pseudogene
• Gene Name: KRT222
• Related Disease:
  Adult lymphoma
  Lymphoma
  Pediatric lymphoma
• UniProt ID: KT222_HUMAN
• Pfam ID: PF00038
• Sequence:
  MELSQLLNEIRANYEKILTRNQIETVLSTRIQLEEDISKKMDKDEEALKAAQAELKEARR
  QWHHLQVEIESLHAVERGLENSLHASEQHYQMQLQDLETVIEGLEKELQEVRRGIEKQLQ
  EHEMLLNTKMRLEQEIATYRHLLEKEEIRYYGCIQGGKKDKKPTTSRVGFVLPSAIINEI
  SFTTKVPQKYENENVETVTKQAILNGSIVKESTEAHGTIQTEKVDEVIKEWEGSFFKDNP
  RLRKKSVSLRFDLHLAATDEGCLETKQDNLPDIEVRLIMRRSCSIPSIKPPSTAN

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Adult lymphoma	DISK8IZR	Strong	Biomarker	[1]
Lymphoma	DISN6V4S	Strong	Biomarker	[1]
Pediatric lymphoma	DIS51BK2	Strong	Biomarker	[1]

7 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Keratin-like protein KRT222 (KRT222).	[2]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Keratin-like protein KRT222 (KRT222).	[3]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Keratin-like protein KRT222 (KRT222).	[4]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Keratin-like protein KRT222 (KRT222).	[3]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Keratin-like protein KRT222 (KRT222).	[5]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Keratin-like protein KRT222 (KRT222).	[7]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of Keratin-like protein KRT222 (KRT222).	[8]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Keratin-like protein KRT222 (KRT222).	[6]

References

• [1] Safety study of culinary-medicinal Royal Sun Agaricus, Agaricus brasiliensis S. Wasser et al. KA21 (higher Basidiomycetes) assessed by prokaryotic as well as eukaryotic systems.Int J Med Mushrooms. 2012;14(2):135-48. doi: 10.1615/intjmedmushr.v14.i2.20.
• [2] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [3] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [4] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [5] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [6] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [7] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [8] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.