Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTTMS7V8)

• DOT Name: LIM and senescent cell antigen-like-containing domain protein 3 (LIMS3)
• Synonyms: Particularly interesting new Cys-His protein 3; PINCH-3
• Gene Name: LIMS3
• Related Disease:
  Advanced cancer
  Carcinoma
  Colon cancer
  Colon carcinoma
  Malignant mesothelioma
  Mesothelioma
  Serous cystadenocarcinoma
• UniProt ID: LIMS3_HUMAN
• Pfam ID: PF00412
• Sequence:
  MAFSGRARPCIIPENEEIPRAALNTVHEANGTEDERAVSKLQRRHSDVKVYKEFCDFYAK
  FNMANALASATCERCKGGFAPAETIVNSNGELYHEQCFVCAQCFQQFPEGLFYEERT
• Tissue Specificity: Detected in testis.

Molecular Interaction Atlas (MIA) of This DOT

7 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Advanced cancer	DISAT1Z9	Strong	Altered Expression	[1]
Carcinoma	DISH9F1N	Strong	Altered Expression	[1]
Colon cancer	DISVC52G	Strong	Altered Expression	[2]
Colon carcinoma	DISJYKUO	Strong	Altered Expression	[2]
Malignant mesothelioma	DISTHJGH	Strong	Altered Expression	[1]
Mesothelioma	DISKWK9M	Strong	Altered Expression	[1]
Serous cystadenocarcinoma	DISVK716	Strong	Altered Expression	[1]

6 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of LIM and senescent cell antigen-like-containing domain protein 3 (LIMS3).	[3]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of LIM and senescent cell antigen-like-containing domain protein 3 (LIMS3).	[4]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of LIM and senescent cell antigen-like-containing domain protein 3 (LIMS3).	[5]
Rifampicin	DM5DSFZ	Approved	Rifampicin decreases the expression of LIM and senescent cell antigen-like-containing domain protein 3 (LIMS3).	[6]
Amiodarone	DMUTEX3	Phase 2/3 Trial	Amiodarone increases the expression of LIM and senescent cell antigen-like-containing domain protein 3 (LIMS3).	[7]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of LIM and senescent cell antigen-like-containing domain protein 3 (LIMS3).	[8]

References

• [1] PINCH-2 expression in cancers involving serosal effusions using quantitative PCR.Cytopathology. 2011 Feb;22(1):22-9. doi: 10.1111/j.1365-2303.2010.00757.x.
• [2] PINCH-2 presents functional copy number variation and suppresses migration of colon cancer cells by paracrine activity.Int J Cancer. 2015 May 15;136(10):2273-83. doi: 10.1002/ijc.29273. Epub 2014 Oct 30.
• [3] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [4] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [5] Identification of transcriptome signatures and biomarkers specific for potential developmental toxicants inhibiting human neural crest cell migration. Arch Toxicol. 2016 Jan;90(1):159-80.
• [6] Integrated analysis of rifampicin-induced microRNA and gene expression changes in human hepatocytes. Drug Metab Pharmacokinet. 2014;29(4):333-40.
• [7] Identification by automated screening of a small molecule that selectively eliminates neural stem cells derived from hESCs but not dopamine neurons. PLoS One. 2009 Sep 23;4(9):e7155.
• [8] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.