Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTTX6071)

• DOT Name: RNA-binding motif, single-stranded-interacting protein 2 (RBMS2)
• Synonyms: Suppressor of CDC2 with RNA-binding motif 3
• Gene Name: RBMS2
• Related Disease:
  Breast cancer
  Breast carcinoma
  Neoplasm
  Pyelonephritis
• UniProt ID: RBMS2_HUMAN
• PDB ID: 1X4E
• Pfam ID: PF00076
• Sequence:
  MLLSVTSRPGISTFGYNRNNKKPYVSLAQQMAPPSPSNSTPNSSSGSNGNDQLSKTNLYI
  RGLQPGTTDQDLVKLCQPYGKIVSTKAILDKTTNKCKGYGFVDFDSPSAAQKAVTALKAS
  GVQAQMAKQQEQDPTNLYISNLPLSMDEQELEGMLKPFGQVISTRILRDTSGTSRGVGFA
  RMESTEKCEAIITHFNGKYIKTPPGVPAPSDPLLCKFADGGPKKRQNQGKFVQNGRAWPR
  NADMGVMALTYDPTTALQNGFYPAPYNITPNRMLAQSALSPYLSSPVSSYQRVTQTSPLQ
  VPNPSWMHHHSYLMQPSGSVLTPGMDHPISLQPASMMGPLTQQLGHLSLSSTGTYMPTAA
  AMQGAYISQYTPVPSSSVSVEESSGQQNQVAVDAPSEHGVYSFQFNK

Molecular Interaction Atlas (MIA) of This DOT

4 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Breast cancer	DIS7DPX1	Strong	Biomarker	[1]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[1]
Neoplasm	DISZKGEW	Strong	Biomarker	[1]
Pyelonephritis	DISAOX93	Strong	Biomarker	[2]

9 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of RNA-binding motif, single-stranded-interacting protein 2 (RBMS2).	[3]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of RNA-binding motif, single-stranded-interacting protein 2 (RBMS2).	[4]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of RNA-binding motif, single-stranded-interacting protein 2 (RBMS2).	[5]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of RNA-binding motif, single-stranded-interacting protein 2 (RBMS2).	[6]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of RNA-binding motif, single-stranded-interacting protein 2 (RBMS2).	[7]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of RNA-binding motif, single-stranded-interacting protein 2 (RBMS2).	[8]
Marinol	DM70IK5	Approved	Marinol increases the expression of RNA-binding motif, single-stranded-interacting protein 2 (RBMS2).	[9]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of RNA-binding motif, single-stranded-interacting protein 2 (RBMS2).	[10]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A affects the expression of RNA-binding motif, single-stranded-interacting protein 2 (RBMS2).	[12]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 increases the phosphorylation of RNA-binding motif, single-stranded-interacting protein 2 (RBMS2).	[11]

References

• [1] RBMS2 inhibits the proliferation by stabilizing P21 mRNA in breast cancer.J Exp Clin Cancer Res. 2018 Dec 4;37(1):298. doi: 10.1186/s13046-018-0968-z.
• [2] dra-related X adhesins of gestational pyelonephritis-associated Escherichia coli recognize SCR-3 and SCR-4 domains of recombinant decay-accelerating factor.Infect Immun. 1995 May;63(5):1663-8. doi: 10.1128/iai.63.5.1663-1668.1995.
• [3] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [4] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [5] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [6] Integrated assessment by multiple gene expression analysis of quercetin bioactivity on anticancer-related mechanisms in colon cancer cells in vitro. Eur J Nutr. 2005 Mar;44(3):143-56. doi: 10.1007/s00394-004-0503-1. Epub 2004 Apr 30.
• [7] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [8] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [9] THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
• [10] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [11] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [12] The genomic response of Ishikawa cells to bisphenol A exposure is dose- and time-dependent. Toxicology. 2010 Apr 11;270(2-3):137-49. doi: 10.1016/j.tox.2010.02.008. Epub 2010 Feb 17.