Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTU12ZTW)

• DOT Name: Hemoglobin subunit theta-1 (HBQ1)
• Synonyms: Hemoglobin theta-1 chain; Theta-1-globin
• Gene Name: HBQ1
• Related Disease: Acute erythroid leukemia
• UniProt ID: HBAT_HUMAN
• Pfam ID: PF00042
• Sequence:
  MALSAEDRALVRALWKKLGSNVGVYTTEALERTFLAFPATKTYFSHLDLSPGSSQVRAHG
  QKVADALSLAVERLDDLPHALSALSHLHACQLRVDPASFQLLGHCLLVTLARHYPGDFSP
  ALQASLDKFLSHVISALVSEYR

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Acute erythroid leukemia	DISZFC1O	Strong	Biomarker	[1]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Hemoglobin subunit theta-1 (HBQ1).	[2]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Hemoglobin subunit theta-1 (HBQ1).	[6]

5 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Hemoglobin subunit theta-1 (HBQ1).	[3]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Hemoglobin subunit theta-1 (HBQ1).	[4]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Hemoglobin subunit theta-1 (HBQ1).	[5]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN decreases the expression of Hemoglobin subunit theta-1 (HBQ1).	[7]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of Hemoglobin subunit theta-1 (HBQ1).	[8]

References

• [1] Structure and expression of the human theta 1 globin gene.Nature. 1988 Jan 7;331(6151):94-6. doi: 10.1038/331094a0.
• [2] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [3] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [4] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [5] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [6] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [7] Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
• [8] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.