Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTU40XWZ)

• DOT Name: Low affinity immunoglobulin epsilon Fc receptor (FCER2)
• Synonyms: BLAST-2; C-type lectin domain family 4 member J; Fc-epsilon-RII; Immunoglobulin E-binding factor; Lymphocyte IgE receptor; CD antigen CD23
• Gene Name: FCER2
• UniProt ID: FCER2_HUMAN
• PDB ID: 1T8C; 1T8D; 2H2R; 2H2T; 4EZM; 4G96; 4G9A; 4GI0; 4GJ0; 4GJX; 4GK1; 4GKO; 4J6J; 4J6K; 4J6L; 4J6M; 4J6N; 4J6P; 4J6Q; 4KI1; 5LGK; 6Y0L; 6Y0M
• Pfam ID: PF00059
• Sequence:
  MEEGQYSEIEELPRRRCCRRGTQIVLLGLVTAALWAGLLTLLLLWHWDTTQSLKQLEERA
  ARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADL
  SSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKG
  TKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHV
  DYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESM
  GPDSRPDPDGRLPTPSAPLHS
• Function: Low-affinity receptor for immunoglobulin E (IgE) and CR2/CD21. Has essential roles in the regulation of IgE production and in the differentiation of B cells. On B cells, initiates IgE-dependent antigen uptake and presentation to T cells. On macrophages, upon IgE binding and antigen cross-linking induces intracellular killing of parasites through activation of L-Arginine-nitric oxide pathway.
• Tissue Specificity: Detected in urine (at protein level).
• KEGG Pathway:
  Hematopoietic cell lineage (hsa04640)
  Epstein-Barr virus infection (hsa05169)
• Reactome Pathway:
  Interleukin-10 signaling (R-HSA-6783783)
  Interleukin-4 and Interleukin-13 signaling (R-HSA-6785807)
  NOTCH2 intracellular domain regulates transcription (R-HSA-2197563)

Molecular Interaction Atlas (MIA) of This DOT

This DOT Affected the Biotransformations of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Nitrite	DMR5XT3	Investigative	Low affinity immunoglobulin epsilon Fc receptor (FCER2) affects the chemical synthesis of Nitrite.	[8]

7 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Low affinity immunoglobulin epsilon Fc receptor (FCER2).	[1]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Low affinity immunoglobulin epsilon Fc receptor (FCER2).	[2]
Cisplatin	DMRHGI9	Approved	Cisplatin affects the expression of Low affinity immunoglobulin epsilon Fc receptor (FCER2).	[3]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Low affinity immunoglobulin epsilon Fc receptor (FCER2).	[3]
Methacholine Chloride	DMGS4QH	Approved	Methacholine Chloride increases the expression of Low affinity immunoglobulin epsilon Fc receptor (FCER2).	[5]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the mutagenesis of Low affinity immunoglobulin epsilon Fc receptor (FCER2).	[6]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Low affinity immunoglobulin epsilon Fc receptor (FCER2).	[7]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic decreases the methylation of Low affinity immunoglobulin epsilon Fc receptor (FCER2).	[4]

References

• [1] Retinoic acid-induced downmodulation of telomerase activity in human cancer cells. Exp Mol Pathol. 2005 Oct;79(2):108-17.
• [2] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [3] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [4] Association of Arsenic Exposure with Whole Blood DNA Methylation: An Epigenome-Wide Study of Bangladeshi Adults. Environ Health Perspect. 2019 May;127(5):57011. doi: 10.1289/EHP3849. Epub 2019 May 28.
• [5] Soluble CD23 and interleukin-1 receptor antagonist in human asthmatics following antigen challenge. J Asthma. 2005 Feb;42(1):73-6. doi: 10.1081/jas-200044761.
• [6] Exome-wide mutation profile in benzo[a]pyrene-derived post-stasis and immortal human mammary epithelial cells. Mutat Res Genet Toxicol Environ Mutagen. 2014 Dec;775-776:48-54. doi: 10.1016/j.mrgentox.2014.10.011. Epub 2014 Nov 4.
• [7] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [8] Role of CD23 in astrocytes inflammatory reaction during HIV-1 related encephalitis. Cytokine. 2001 Jul 21;15(2):96-107. doi: 10.1006/cyto.2001.0896.