Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTUO018X)

• DOT Name: Major facilitator superfamily domain-containing protein 4A (MFSD4A)
• Synonyms: Major facilitator superfamily domain-containing protein 4
• Gene Name: MFSD4A
• Related Disease:
  Gastric cancer
  Neoplasm
  Stomach cancer
• UniProt ID: MFD4A_HUMAN
• Pfam ID: PF07690
• Sequence:
  MGCDGRVSGLLRRNLQPTLTYWSVFFSFGLCIAFLGPTLLDLRCQTHSSLPQISWVFFSQ
  QLCLLLGSALGGVFKRTLAQSLWALFTSSLAISLVFAVIPFCRDVKVLASVMALAGLAMG
  CIDTVANMQLVRMYQKDSAVFLQVLHFFVGFGALLSPLIADPFLSEANCLPANSTANTTS
  RGHLFHVSRVLGQHHVDAKPWSNQTFPGLTPKDGAGTRVSYAFWIMALINLPVPMAVLML
  LSKERLLTCCPQRRPLLLSADELALETQPPEKEDASSLPPKFQSHLGHEDLFSCCQRKNL
  RGAPYSFFAIHITGALVLFMTDGLTGAYSAFVYSYAVEKPLSVGHKVAGYLPSLFWGFIT
  LGRLLSIPISSRMKPATMVFINVVGVVVTFLVLLIFSYNVVFLFVGTASLGLFLSSTFPS
  MLAYTEDSLQYKGCATTVLVTGAGVGEMVLQMLVGSIFQAQGSYSFLVCGVIFGCLAFTF
  YILLLFFHRMHPGLPSVPTQDRSIGMENSECYQR

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Gastric cancer	DISXGOUK	Strong	Altered Expression	[1]
Neoplasm	DISZKGEW	Strong	Biomarker	[1]
Stomach cancer	DISKIJSX	Strong	Altered Expression	[1]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
NAPQI	DM8F5LR	Investigative	Major facilitator superfamily domain-containing protein 4A (MFSD4A) affects the response to substance of NAPQI.	[9]

7 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Major facilitator superfamily domain-containing protein 4A (MFSD4A).	[2]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Major facilitator superfamily domain-containing protein 4A (MFSD4A).	[3]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of Major facilitator superfamily domain-containing protein 4A (MFSD4A).	[4]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of Major facilitator superfamily domain-containing protein 4A (MFSD4A).	[5]
Folic acid	DMEMBJC	Approved	Folic acid decreases the expression of Major facilitator superfamily domain-containing protein 4A (MFSD4A).	[6]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Major facilitator superfamily domain-containing protein 4A (MFSD4A).	[7]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Major facilitator superfamily domain-containing protein 4A (MFSD4A).	[8]

References

• [1] Metastatic pathway-specific transcriptome analysis identifies MFSD4 as a putative tumor suppressor and biomarker for hepatic metastasis in patients with gastric cancer.Oncotarget. 2016 Mar 22;7(12):13667-79. doi: 10.18632/oncotarget.7269.
• [2] Stem cell transcriptome responses and corresponding biomarkers that indicate the transition from adaptive responses to cytotoxicity. Chem Res Toxicol. 2017 Apr 17;30(4):905-922.
• [3] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [4] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [5] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [6] Folic acid supplementation dysregulates gene expression in lymphoblastoid cells--implications in nutrition. Biochem Biophys Res Commun. 2011 Sep 9;412(4):688-92. doi: 10.1016/j.bbrc.2011.08.027. Epub 2011 Aug 16.
• [7] Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
• [8] Cellular reactions to long-term volatile organic compound (VOC) exposures. Sci Rep. 2016 Dec 1;6:37842. doi: 10.1038/srep37842.
• [9] Acetaminophen-NAPQI hepatotoxicity: a cell line model system genome-wide association study. Toxicol Sci. 2011 Mar;120(1):33-41. doi: 10.1093/toxsci/kfq375. Epub 2010 Dec 22.