Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTV09JH1)

DOT Name Uridine diphosphate glucose pyrophosphatase NUDT22 (NUDT22)
Synonyms UDPG pyrophosphatase; UGPPase; EC 3.6.1.45; Nucleoside diphosphate-linked moiety X motif 22; Nudix motif 22
Gene Name NUDT22
UniProt ID
NUD22_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
5LF9; 5LOR; 5LOU; 5R50; 5R51; 5R52; 5R53; 5R54; 5R55; 5R56; 5R57; 5R58; 5R59; 5R5A; 5R5B; 5R5C; 5R5D; 5R5E; 5R5F; 5R5G; 5R5H; 5R5I; 5R5J; 5R5K; 5R5L; 5R5M; 5R5N; 5R5O; 5R5P; 5R5Q; 5R5R; 5R5S; 5RKZ
EC Number
3.6.1.45
Sequence
MDPEVTLLLQCPGGGLPQEQIQAELSPAHDRRPLPGGDEAITAIWETRLKAQPWLFDAPK
FRLHSATLAPIGSRGPQLLLRLGLTSYRDFLGTNWSSSAAWLRQQGATDWGDTQAYLADP
LGVGAALATADDFLVFLRRSRQVAEAPGLVDVPGGHPEPQALCPGGSPQHQDLAGQLVVH
ELFSSVLQEICDEVNLPLLTLSQPLLLGIARNETSAGRASAEFYVQCSLTSEQVRKHYLS
GGPEAHESTGIFFVETQNVQRLLETEMWAELCPSAKGAIILYNRVQGSPTGAALGSPALL
PPL
Function Hydrolyzes UDP-glucose to glucose 1-phosphate and UMP and UDP-galactose to galactose 1-phosphate and UMP. Preferred substrate is UDP-glucose.

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Uridine diphosphate glucose pyrophosphatase NUDT22 (NUDT22). [1]
------------------------------------------------------------------------------------
4 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Doxorubicin DMVP5YE Approved Doxorubicin increases the expression of Uridine diphosphate glucose pyrophosphatase NUDT22 (NUDT22). [2]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Uridine diphosphate glucose pyrophosphatase NUDT22 (NUDT22). [3]
Menadione DMSJDTY Approved Menadione affects the expression of Uridine diphosphate glucose pyrophosphatase NUDT22 (NUDT22). [4]
Milchsaure DM462BT Investigative Milchsaure decreases the expression of Uridine diphosphate glucose pyrophosphatase NUDT22 (NUDT22). [5]
------------------------------------------------------------------------------------

References

1 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
2 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
3 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
4 Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
5 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.