Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTV3I2W1)

DOT Name PiggyBac transposable element-derived protein 3 (PGBD3)
Gene Name PGBD3
Related Disease
Cockayne syndrome type 2 ( )
Craniosynostosis 2 ( )
Hepatocellular carcinoma ( )
UniProt ID
PGBD3_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF13843
Sequence
MPRTLSLHEITDLLETDDSIEASAIVIQPPENATAPVSDEESGDEEGGTINNLPGSLLHT
AAYLIQDGSDAESDSDDPSYAPKDDSPDEVPSTFTVQQPPPSRRRKMTKILCKWKKADLT
VQPVAGRVTAPPNDFFTVMRTPTEILELFLDDEVIELIVKYSNLYACSKGVHLGLTSSEF
KCFLGIIFLSGYVSVPRRRMFWEQRTDVHNVLVSAAMRRDRFETIFSNLHVADNANLDPV
DKFSKLRPLISKLNERCMKFVPNETYFSFDEFMVPYFGRHGCKQFIRGKPIRFGYKFWCG
ATCLGYICWFQPYQGKNPNTKHEEYGVGASLVLQFSEALTEAHPGQYHFVFNNFFTSIAL
LDKLSSMGHQATGTVRKDHIDRVPLESDVALKKKERGTFDYRIDGKGNIVCRWNDNSVVT
VASSGAGIHPLCLVSRYSQKLKKKIQVQQPNMIKVYNQFMGGVDRADENIDKYRASIRGK
KWYSSPLLFCFELVLQNAWQLHKTYDEKPVDFLEFRRRVVCHYLETHGHPPEPGQKGRPQ
KRNIDSRYDGINHVIVKQGKQTRCAECHKNTTFRCEKCDVALHVKCSVEYHTE
Function
Binds in vitro to PGBD3-related transposable elements, called MER85s; these non-autonomous 140 bp elements are characterized by the presence of PGBD3 terminal inverted repeats and the absence of internal transposase ORF.
Tissue Specificity Expressed in heart and oocytes, but not in granulosa cells (at protein level).

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Cockayne syndrome type 2 DIS3X0GQ Strong Biomarker [1]
Craniosynostosis 2 DISBJX9D Strong Biomarker [1]
Hepatocellular carcinoma DIS0J828 Strong Biomarker [2]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
3 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of PiggyBac transposable element-derived protein 3 (PGBD3). [3]
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 decreases the phosphorylation of PiggyBac transposable element-derived protein 3 (PGBD3). [10]
Coumarin DM0N8ZM Investigative Coumarin increases the phosphorylation of PiggyBac transposable element-derived protein 3 (PGBD3). [10]
------------------------------------------------------------------------------------
7 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of PiggyBac transposable element-derived protein 3 (PGBD3). [4]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of PiggyBac transposable element-derived protein 3 (PGBD3). [5]
Quercetin DM3NC4M Approved Quercetin decreases the expression of PiggyBac transposable element-derived protein 3 (PGBD3). [6]
Marinol DM70IK5 Approved Marinol decreases the expression of PiggyBac transposable element-derived protein 3 (PGBD3). [7]
Urethane DM7NSI0 Phase 4 Urethane increases the expression of PiggyBac transposable element-derived protein 3 (PGBD3). [8]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the expression of PiggyBac transposable element-derived protein 3 (PGBD3). [9]
Formaldehyde DM7Q6M0 Investigative Formaldehyde decreases the expression of PiggyBac transposable element-derived protein 3 (PGBD3). [11]
------------------------------------------------------------------------------------
⏷ Show the Full List of 7 Drug(s)

References

1 Tethering of the conserved piggyBac transposase fusion protein CSB-PGBD3 to chromosomal AP-1 proteins regulates expression of nearby genes in humans.PLoS Genet. 2012 Sep;8(9):e1002972. doi: 10.1371/journal.pgen.1002972. Epub 2012 Sep 27.
2 Six genes as potential diagnosis and prognosis biomarkers for hepatocellular carcinoma through data mining.J Cell Physiol. 2019 Jun;234(6):9787-9792. doi: 10.1002/jcp.27664. Epub 2018 Dec 17.
3 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
4 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
5 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
6 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
7 THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
8 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
9 Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
10 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
11 Gene expression changes in primary human nasal epithelial cells exposed to formaldehyde in vitro. Toxicol Lett. 2010 Oct 5;198(2):289-95.